KEGG   Xenopus laevis (African clawed frog): 431974Help
Entry
431974            CDS       T01010                                 

Gene name
traf2
Definition
TNF receptor-associated factor 2
Orthology
K03173  
TNF receptor-associated factor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    431974 (traf2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    431974 (traf2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    431974 (traf2)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    431974 (traf2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    431974 (traf2)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    431974 (traf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 461 aa AA seqDB search
MASAVAAAVSVSPQGSLDLNQPGFKKEILGTKLEVKYLCSDCKNLLRRPLQAQCGHRYCS
HCFSKIISSGPQKCAACIQEGLYEDGVSMLESSSAFPDNAARREVESLPAICNNVNCTWK
GTIKEFEVGHEGKCQFMLVPCPVCKALIRAIDRDLHNERECPERKLNCRYCKLSVYFPDI
KVHDEICPKFPMTCEGCGRKKIPREKFQDHIKGCGRCKVPCRYAAVGCAEMVENDKCLEH
ENKFLAEHLAKVWDYIQRDIKEQKDLLLRVGSLSVQGSSTPGHNALPVPPNDSTKVKEIL
QKLDTLDKKTTTFEKIVSVLNGKVEWSSHATEELMKQLLAAQEKVESLTNKVRQLEFTLG
QKELVLAEMGTRMQESEFSTYDGVFIWKISELGKKRLDAASGRCPAIFSPPFYTNKYGYK
MCLRIYLDGDGTGRGTHISLFFVVMKGITDALLRWPFNQKP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggcagtggcagcagcagtgtctgtctctccgcagggatcactggacctgaac
cagccgggatttaaaaaagagattctgggcaccaagcttgaagtgaaatatctgtgttct
gactgcaagaatttattacggagacccctccaagcccagtgtggccaccgctactgctcc
cattgcttcagcaaaattatcagctctgggccccagaagtgcgctgcgtgtatccaggaa
gggctctatgaggatggtgtctccatgctggaaagtagctccgcgttcccagataatgca
gcacgacgagaggtcgagagtcttcccgccatttgcaataacgtcaactgcacctggaaa
ggaaccatcaaagaatttgaggttggccatgaggggaagtgccagttcatgttagtgcca
tgccctgtgtgtaaagccctgatccgtgccattgacagggacttgcataacgagagagag
tgcccggagcgcaagctaaactgccgatactgcaagttgtcagtctactttcctgacatt
aaggttcatgatgaaatctgccccaagtttcccatgacgtgcgaaggctgcgggcgtaag
aagatcccgcgggaaaagtttcaggaccacattaaaggttgtggcaggtgcaaagtgccg
tgtcgatatgcagcagttggttgtgccgagatggtggagaatgataagtgtctggaacat
gaaaacaaattcttggccgagcacttggccaaagtgtgggactatattcagcgagacata
aaggagcagaaagacttgttactccgtgtgggatcgctgtccgtgcagggcagctccact
ccagggcacaacgcgctgccagtgccgcccaacgactcgaccaaggtcaaggaaattctg
cagaagttggacaccctggataagaaaactacaacatttgaaaaaattgtgagtgtcctg
aacggaaaggtggaatggtcgtcacatgcgactgaggagctcatgaaacagcttttggct
gcacaggagaaagtggagtctttaaccaacaaggtgcgacagctggaattcactttgggg
cagaaggaactggttttagcagaaatgggaactcggatgcaggagtcagaattctccacc
tacgatggggtgtttatttggaaaatctctgaactcggcaaaaagagactcgatgccgca
agtggacgatgccccgccatattctccccacctttttacactaacaagtatggctataag
atgtgcctgcgaatctacctggatggagacgggactgggcggggaacgcacatctctctc
ttcttcgtggtgatgaaggggatcactgatgctttgctgcgctggccctttaaccaaaag
ccttga

DBGET integrated database retrieval system