KEGG   Xenopus laevis (African clawed frog): 431996Help
Entry
431996            CDS       T01010                                 

Gene name
whsc1
Definition
Wolf-Hirschhorn syndrome candidate 1 (EC:2.1.1.43)
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:xla00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 487 aa AA seqDB search
MKQVPHILGSPAVKPSNPEVSRECSVLLGRAQISASLQEGVIQKINGHDSLPFIPTEKLK
DLTSRVFNGESGAQEAKVRIEAQEVQGIETPPSTTPTKNGSPEIKLKITKTYMNGKPLFE
SSICGDRGEEESQPEAKEKKKRGRKRKIITSEANEKSSQEMPADSESSKMESVSESEFPE
HKTKEDILLKYSVGDVVWSKVSGYPWWPCMVTSDPVLYSHTKVKGQKKNVRQYHVQFFGN
APERAWISEKSMVPFKGENEYDHLCQESAKQASTKAEKTKLLKPITGKIRVQWDIGIEQA
KEAVLMTPEERKEKFTFIYIKDRPQLNPKVAAEVGIPVETPEKSMESPKKEGVSSYKRRR
VSRTPAASEEVDPADKTTTAKGPENSSDLKFGMASPASKKRSGAYTPRSRKGDAMNQFLV
FCQKHKDEVINEHPDASDEEIEELLESQWNMLSNKQKARYNTKFAILTSPKSEEDSGKHE
NALSKGF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtacctcatatcctcggaagtccagctgtgaagccatccaatccagaagtg
agccgagagtgttctgtgttgcttggaagagctcagatctcagcttccctccaagagggg
gttatacagaagatcaatggccacgattccctgcccttcattccaactgagaagttaaag
gacctcacctcccgcgtgttcaacggagagtctggagctcaggaagccaaagtgcgcatt
gaggcgcaagaggttcaaggtattgaaacgccacccagcactactcctactaaaaacgga
tctcccgaaataaagctgaaaatcactaagacctacatgaatggaaagcccttgtttgag
tcttcaatatgtggggacagaggggaggaagagtctcaacctgaggcaaaggaaaagaaa
aagagaggaaggaaaagaaaaattatcacatctgaagccaatgagaagtcgagccaagag
atgccagctgactcggaatcttccaaaatggagtctgtatctgaatcggagttcccagag
cacaagactaaagaggacatattattaaaatactctgttggagatgttgtatggtccaag
gtctctggttatccatggtggccgtgtatggtgacatctgaccctgtgttgtatagccac
acaaaagtaaaggggcaaaaaaagaacgtcaggcaatatcatgtacagttttttggtaac
gcgcctgagcgagcttggatatccgaaaagagcatggtgcccttcaaaggagaaaatgaa
tacgatcacttgtgccaggaaagtgcaaaacaggcatccaccaaagcagaaaaaactaag
cttttaaaacccataacaggcaaaatccgggttcagtgggacatcggtatagagcaggcc
aaagaagccgtattgatgactcccgaagaaaggaaagaaaagtttacttttatttacata
aaagaccgtcctcaactcaatcccaaagtggctgctgaagtgggtatcccagtggagacc
ccagagaagagtatggaaagccccaaaaaagaaggggtttcgtcgtacaagagaagacga
gtgtccagaaccccagctgctagtgaagaagttgatcctgctgataaaaccactactgca
aaaggacctgagaactcctcagaccttaaatttgggatggcttcgcctgcaagtaaaaaa
aggtctggcgcatatacccctaggagcaggaagggagatgccatgaaccagtttcttgta
ttttgtcagaagcacaaagatgaggtaataaacgaacacccagacgcatctgatgaagag
attgaagaattgcttgaatcccagtggaatatgctcagcaataaacaaaaagctcgctat
aatacaaagtttgccattctcacctctcccaaatcagaagaagactctggtaaacatgaa
aacgcactgtctaagggattttaa

DBGET integrated database retrieval system