KEGG   Xenopus laevis (African clawed frog): 432021Help
Entry
432021            CDS       T01010                                 

Definition
uncharacterized protein MGC82221
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    432021
  Lipid metabolism
   00071 Fatty acid degradation
    432021
  Amino acid metabolism
   00350 Tyrosine metabolism
    432021
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    432021
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    432021
   00982 Drug metabolism - cytochrome P450
    432021
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     432021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MTTAGNVIKCKAAVAWAPKQPLSIEDIEVAPPKAHEIRVKMVATGICGSDDTVLSGSFSS
IKFPVILGHEGAGIVESVGTGVKNVKPGDKVIALFQPQCGECQNCLNPKSNMCFKSDLGK
YTGMMLDNTSRFTCKGKLIHHFMHTSTFTEYTVLDEIAVAKIQDDAPLDKVCLISCGFSA
GYGSVLNTAQVKQGSTCAVFGLGGVGLSVVIGCRVAGAAKIIGVDTNSDKFPKAKEIGAT
ECVNPNDYKEPIHKVLEKMTEGGLDYSFECVGNTSVMASALLSTNYSYGTSVIVGVAPLA
AELNLNPMEILTGRTLKGTLFGGWKGRDCVPKLVADFMAKKFELDGLITHRLPLQNINEG
FDLLHKGESLRTVLYFC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgccggaaacgtgattaagtgcaaggctgcggtggcctgggcacctaagcaa
cctctcagcattgaggacattgaagttgctcctccaaaggcacatgaaattcgtgtaaag
atggtggcaactgggatttgtggttcagatgacacggtactaagtggatcattcagttct
ataaagttcccagtgattctgggccatgaaggtgctggtatagtggaaagcgttggcaca
ggagtgaaaaatgtaaaaccaggagacaaagtcatcgcactctttcaaccccagtgtgga
gaatgccaaaactgtttaaatcccaagagcaacatgtgcttcaaatcggaccttggaaaa
tatactggaatgatgttggacaacaccagcagatttacatgcaagggaaagctaatccac
cactttatgcataccagcacctttactgaatacactgtgttggatgaaatagcagttgct
aagatacaggatgatgctcctctagataaagtttgtttgatttcctgtgggttttctgct
ggttatggctctgttctaaacactgcccaggttaaacaagggtccacatgtgctgtgttt
ggcctgggtggtgttggtctctctgtggttattggatgtagagtagctggtgctgctaag
atcattggagtggatacaaacagtgataagtttccaaaagctaaagaaataggagctaca
gaatgtgtcaacccaaatgattataaggagcctatccacaaagtgttggaaaaaatgact
gaagggggactagattactcatttgagtgtgttggaaacaccagtgtcatggcatctgct
cttctatccacaaactattcatatggtacatcagtgattgttggtgtagctcctttagca
gcagaactgaacttgaatcctatggagatactcacaggacgcactttgaaaggaactcta
tttggaggatggaagggcagggattgtgtcccaaaactggttgctgattttatggcaaag
aagtttgaactggatgggctgataactcacaggctaccactgcaaaatatcaatgaagga
tttgatctcttgcacaaaggagaaagccttcgcactgttctgtatttctgctga

DBGET integrated database retrieval system