KEGG   Xenopus laevis (African clawed frog): 432021Help
Entry
432021            CDS       T01010                                 

Definition
uncharacterized protein MGC82221
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xla00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:xla00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xla00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xla00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:xla00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:xla00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MTTAGNVIKCKAAVAWAPKQPLSIEDIEVAPPKAHEIRVKMVATGICGSDDTVLSGSFSS
IKFPVILGHEGAGIVESVGTGVKNVKPGDKVIALFQPQCGECQNCLNPKSNMCFKSDLGK
YTGMMLDNTSRFTCKGKLIHHFMHTSTFTEYTVLDEIAVAKIQDDAPLDKVCLISCGFSA
GYGSVLNTAQVKQGSTCAVFGLGGVGLSVVIGCRVAGAAKIIGVDTNSDKFPKAKEIGAT
ECVNPNDYKEPIHKVLEKMTEGGLDYSFECVGNTSVMASALLSTNYSYGTSVIVGVAPLA
AELNLNPMEILTGRTLKGTLFGGWKGRDCVPKLVADFMAKKFELDGLITHRLPLQNINEG
FDLLHKGESLRTVLYFC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgccggaaacgtgattaagtgcaaggctgcggtggcctgggcacctaagcaa
cctctcagcattgaggacattgaagttgctcctccaaaggcacatgaaattcgtgtaaag
atggtggcaactgggatttgtggttcagatgacacggtactaagtggatcattcagttct
ataaagttcccagtgattctgggccatgaaggtgctggtatagtggaaagcgttggcaca
ggagtgaaaaatgtaaaaccaggagacaaagtcatcgcactctttcaaccccagtgtgga
gaatgccaaaactgtttaaatcccaagagcaacatgtgcttcaaatcggaccttggaaaa
tatactggaatgatgttggacaacaccagcagatttacatgcaagggaaagctaatccac
cactttatgcataccagcacctttactgaatacactgtgttggatgaaatagcagttgct
aagatacaggatgatgctcctctagataaagtttgtttgatttcctgtgggttttctgct
ggttatggctctgttctaaacactgcccaggttaaacaagggtccacatgtgctgtgttt
ggcctgggtggtgttggtctctctgtggttattggatgtagagtagctggtgctgctaag
atcattggagtggatacaaacagtgataagtttccaaaagctaaagaaataggagctaca
gaatgtgtcaacccaaatgattataaggagcctatccacaaagtgttggaaaaaatgact
gaagggggactagattactcatttgagtgtgttggaaacaccagtgtcatggcatctgct
cttctatccacaaactattcatatggtacatcagtgattgttggtgtagctcctttagca
gcagaactgaacttgaatcctatggagatactcacaggacgcactttgaaaggaactcta
tttggaggatggaagggcagggattgtgtcccaaaactggttgctgattttatggcaaag
aagtttgaactggatgggctgataactcacaggctaccactgcaaaatatcaatgaagga
tttgatctcttgcacaaaggagaaagccttcgcactgttctgtatttctgctga

DBGET integrated database retrieval system