KEGG   Xenopus laevis (African clawed frog): 432036Help
Entry
432036            CDS       T01010                                 

Definition
uncharacterized protein MGC81499
Orthology
K02206  
cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Progesterone-mediated oocyte maturation
Herpes simplex infection
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    432036
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    432036
   04114 Oocyte meiosis
    432036
   04115 p53 signaling pathway
    432036
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    432036
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    432036
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     432036
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   432036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 297 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKARNRDTGEIVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLNQDLKKFMDASNISGISLALVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTYTHEVVTLWYTAPEILLGCKFY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTF
PKWIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKAALTHPFFRDVSRPTPHLI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggagaatttccagaaggtggagaagatcggggagggcacgtacggggtggtgtacaaa
gctcggaaccgagacaccggggagattgtggctctgaaaaagatacgcctggacactgag
acagaaggagttccaagcacagccatccgggaaatttccctcctcaaagaactgaatcat
cccaatattgtgaagcttcttgatgtcattcacacagaaaacaagctctaccttgtcttt
gagttccttaaccaagatctgaagaaattcatggatgcttcaaatatttctggaatttca
ctggccctagttaaaagctatctgttccagttgctccagggtttggctttctgccactcg
catcgtgtcttacatcgtgatcttaaaccacagaacctgcttattaattctgatggagcc
atcaagcttgctgactttggactagctcgggcatttggtgtgcctgtgagaacctatact
catgaggttgtcactctgtggtacacagcaccagaaatccttcttggctgcaagttctac
tccacggctgtagatatctggagcctgggatgtatttttgcagaaatgatcacgaggcga
gcgctttttccaggagattctgaaattgatcaactctttcgcatctttcgaaccctgggg
acccctgatgaagtgtcctggccaggagtaacaactatgcccgattacaaatcaaccttt
cccaagtggatcagacaagactttagcaaagtggtgccgcctttggatgaggatggtcga
gacctcttagctcaaatgcttcagtatgactccaacaaacgtatttctgctaaggcagcg
ctgacccatcctttcttccgagatgtgagcagaccaacaccacatctgatttag

DBGET integrated database retrieval system