KEGG   Xenopus laevis (African clawed frog): 432076Help
Entry
432076            CDS       T01010                                 

Gene name
bckdk
Definition
branched chain ketoacid dehydrogenase kinase (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 413 aa AA seqDB search
MFRKTLLDLAGRGALKPLPVTLSLLPIRSRSTSATDHHHTELARERSKTVTSFYNQSGID
ISAEKASVRLTPTTMLYSGRSQDGSHILKSARYLHKELPVRISHRIKGFRSLPFIIGCNP
TILHVHELYIRAFQKLSEFPPISDHETESQYCKLLRQLLDDHKDVVTQLAEGLRESRKHI
QDEKVISYFLDKTLTSRLGIRMLATHHLALHEERPDFVGIICTRLWPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNSMRATMESHIDTPYNVPDISI
TIANNDIDFIIRISDRGGGIPHDHLERVMDYHFTTAETSTQDPRINPIFGNMVDMVNSGQ
SGPMHGFGFGLPTSRAYAEYLGGSLCIQSLQGIGTDVYLRLKHIDGREESFRI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttccggaagaccctgttggatttggcgggccggggggctctaaagccccttccagtt
actttatcactcctgcccattcgttctcgctccacctctgccacagaccaccaccatact
gaactggccagggagcgctccaaaactgtcacctctttctacaaccaatccggcattgat
atttcagcagagaaggcctctgtccggctcactccaactactatgctttactcgggaagg
tctcaggatggcagccatattctgaaaagtgctcgctacttgcacaaggagctcccggtc
cggatttcccatcgcatcaaaggcttccgcagtctcccgtttatcatcggctgcaatcca
acaatcctgcatgtgcacgagttgtacatccgagccttccagaagctgagcgagttcccc
ccgatctctgaccatgagacggagagtcagtactgtaagctcctgaggcagctgctcgat
gatcacaaggacgtggtgactcaattggcggaggggttaagagaaagccggaaacacatc
caggatgagaaagtcatcagttatttcctggataagactttaacctcacgcctgggcatc
cgaatgttggcaacacaccacctggctctgcacgaagaacggccagactttgttggcatt
atctgtacccgcctgtggcctaagaagatcattgagaaatgggtggactttgccaggcgt
ctgtgtgaacacaagtatggaaatgccccccgagttcgcattaatggccatgttgctgct
cgattccctttcatccccatgccactggattacattctaccggagctgctcaaaaactct
atgcgggccaccatggaaagtcacattgacactccctacaacgtcccagacatttcaatt
accatcgctaataacgacattgacttcataatcaggatctcagaccgaggaggtgggatc
ccacacgatcacttggaacgggtaatggattaccactttaccactgcagagaccagcact
caggatccccgcatcaaccccatttttggaaacatggtggacatggtgaacagcggccag
tcgggccctatgcacggttttggctttggcctccccacgtcccgggcatacgcggagtat
ctgggcggatccctgtgcatccagtctctccaaggcattggcacggacgtctacctgcgg
ctcaagcacatcgatggcagagaagaaagcttccgcatctga

DBGET integrated database retrieval system