KEGG   Xenopus laevis (African clawed frog): 432080Help
Entry
432080            CDS       T01010                                 

Gene name
pdk1
Definition
pyruvate dehydrogenase kinase, isozyme 1 (EC:2.7.11.2)
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     432080 (pdk1)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   432080 (pdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 412 aa AA seqDB search
MRLLRALMRSAPLSSRNTPSLVDFYSKFSPSPLSMKQFLDFGSVNACEKTSFIFLRHELP
VRLANIMKEINLLPDNLLKMPSIKLVQSWYVQSFQEIIDFKDTNAEDLNTVQKFTDTVIT
IRNRHNDVIPTMAQGVVEFKDSFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHTLLFGG
EVKVNPAHPKHIGSIDPACNVVDVVKDGYENAKHLCDLYYMSSPELELTEFNAKSPGQPI
QVVYVPSHLYHMVFELFKNAMRATMEFQADKGVYPPIKVHVVLGSEDLTVKLSDRGGGVP
LRKIERLFNYMYSTAPLPRMETSRATPLAGFGYGLPISRLYAKYFQGDLKLYSLEGYGTD
AVIYFKALSTESVERLPVYNKSAWKHYKTNHEADDWCVPSSEPKDMTTFRSN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaggctactcagagctttgatgagaagcgcccccctatccagcagaaataccccgagc
ctggttgacttctactctaagttttccccgtcccccctgtccatgaaacagttcctggat
ttcggttcagtgaatgcgtgtgaaaagacatcatttatatttctgaggcatgaattgcca
gtacgattagcaaacatcatgaaagagataaatctgcttccagacaacctcctgaagatg
ccatctattaagctagttcagagctggtatgttcagagcttccaagaaataattgatttc
aaggacaccaatgcagaggacttaaatacagtccaaaaattcacagacacagtgatcacc
atccggaatcgacacaatgatgtcatcccaactatggctcagggagtggttgaatttaaa
gacagttttggggtagatccagtaacttctcagaatgtgcagtattttttagaccgcttt
tacatgagtcgcatatcgattagaatgctgctaaatcaacacactttgctctttggaggg
gaagtgaaagtgaatccagcacatccgaagcacattggtagcattgacccagcatgcaat
gttgttgacgtagttaaagatggatatgaaaatgcaaaacatctgtgtgatttgtattat
atgagctccccggaactagagttaacagagttcaacgctaaatctccaggacagcccatt
caagtggtgtatgtgccatctcatctctaccacatggtgtttgaactgttcaagaatgca
atgagagccaccatggaattccaggcagacaaaggagtctatcctcctatcaaagtgcat
gtggttttgggcagtgaggatttaacagttaagctcagtgatcgaggtggaggtgttcct
ctaaggaaaatcgagcgcttgttcaactacatgtattctactgcgccactgcctcgaatg
gaaacatcccgtgctaccccattggccgggtttgggtatggcttgccaatatctcgcctc
tatgcaaagtattttcaaggagacttgaagttatattcgctggagggttatgggacagat
gctgttatatactttaaggctttatcaacagagtcagtggagaggcttcctgtgtacaat
aaatctgcctggaaacattacaagaccaaccatgaagcagacgactggtgcgtccccagc
agtgagcccaaggacatgaccacctttcgcagcaactga

DBGET integrated database retrieval system