KEGG   Xenopus laevis (African clawed frog): 432172Help
Entry
432172            CDS       T01010                                 

Gene name
MGC78893, akt2-b
Definition
RAC-beta serine/threonine-protein kinase B (EC:2.7.11.1)
Orthology
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:xla04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:xla04370]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:xla04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xla04150]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xla04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
Cellular Processes; Cell communication; Tight junction [PATH:xla04530]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xla04620]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xla04920]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xla04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPDSTEHSLLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVPEDEE
EEAMEVKYGSPSDVSSAEQMDVAMSKGRPKVTMNDFDYLKLLGKGTFGKVILVREKATGL
YYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTGLKYAFQTSDRLCFVMEYANGGE
LFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFGL
CKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
RLFELILMEETRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPDDAQEVMSHGFFASINWQD
VTERKLSPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESEQRPHFPQFSYS
SSIRE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgatggtgattaaagaaggttggcttcaaaaaagaggggagtatataaaa
acatggagaccaagatatttccttctgaaaagtgatggttcatttattggctataaagag
aaacctgactccacagagcacagtcttcttcctcccctcaataacttctctgttgcagaa
tgtcagctaatgaagacggagcggcctaggcccaacacatttgtgattcggtgcttacaa
tggacgacagttattgaacggacttttcatgttgacacaccagaggaaagggaagaatgg
attattgccatccagacagtggccaatggcctgaagaaccaggtacctgaagatgaagag
gaggaagccatggaagttaagtatggctcccccagtgatgtctcgagtgcagagcagatg
gacgttgcaatgtccaaagggcgccccaaagtgaccatgaatgattttgactacctcaaa
ttgctgggaaaagggacctttgggaaggttatccttgttcgagagaaagctaccggactt
tactatgctatgaagatccttcgaaaagaggtcataattgctaaggatgaagttgctcat
acactaacagaaagcagagttttgcagaacacaaaacacccgtttttaacgggattaaag
tatgcatttcagaccagtgacagactctgctttgttatggaatatgctaatggtggagag
ctttttttccacctttcacgagaacgagtttttacagaggacagagcacgcttttatggt
gcagaaattgtgtcggctttagaatatctacattctcgaaacgtagtatacagagacatt
aagctggagaatctcatgctggataaggatggccatgtcaagattacagattttggtttg
tgtaaggaaggcatcacagatggagccactatgaggactttctgtggcacaccagagtat
cttgcgcctgaggtgcttgaagataacgactatggccgagccgtggactggtggggtctc
ggagttgtgatgtatgaaatgatgtgtggccgattgcccttttataaccaagaccatgag
aggttattcgaacttatcctcatggaggagacccgctttccccgtacattaagtccagag
gcaaaatctctgcttgctgggcttttgaaaaaggatcctaaacagagattaggagggggt
cctgatgatgcccaagaggtcatgtcgcatggattctttgcttctatcaattggcaagat
gtaacggagagaaagctctcccctcctttcaagccacaagtcacatccgagattgacaca
agatattttgatgacgagtttacggctcagtctataacattgacccctcctgacagatat
gataaccttgatgccttagaatcagagcagcgccctcattttcctcaattctcttattct
tcaagcatacgggaataa

DBGET integrated database retrieval system