KEGG   Xenopus laevis (African clawed frog): 432172Help
Entry
432172            CDS       T01010                                 

Gene name
MGC78893, akt2-b
Definition
RAC-beta serine/threonine-protein kinase B (EC:2.7.11.1)
Orthology
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    432172 (MGC78893)
   04012 ErbB signaling pathway
    432172 (MGC78893)
   04370 VEGF signaling pathway
    432172 (MGC78893)
   04630 Jak-STAT signaling pathway
    432172 (MGC78893)
   04068 FoxO signaling pathway
    432172 (MGC78893)
   04150 mTOR signaling pathway
    432172 (MGC78893)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    432172 (MGC78893)
  Cellular commiunity
   04510 Focal adhesion
    432172 (MGC78893)
   04530 Tight junction
    432172 (MGC78893)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    432172 (MGC78893)
  Endocrine system
   04910 Insulin signaling pathway
    432172 (MGC78893)
   04920 Adipocytokine signaling pathway
    432172 (MGC78893)
   04914 Progesterone-mediated oocyte maturation
    432172 (MGC78893)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    432172 (MGC78893)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     432172 (MGC78893)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: AGC group
  AKT family
   432172 (MGC78893)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPDSTEHSLLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVPEDEE
EEAMEVKYGSPSDVSSAEQMDVAMSKGRPKVTMNDFDYLKLLGKGTFGKVILVREKATGL
YYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTGLKYAFQTSDRLCFVMEYANGGE
LFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFGL
CKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
RLFELILMEETRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPDDAQEVMSHGFFASINWQD
VTERKLSPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESEQRPHFPQFSYS
SSIRE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgatggtgattaaagaaggttggcttcaaaaaagaggggagtatataaaa
acatggagaccaagatatttccttctgaaaagtgatggttcatttattggctataaagag
aaacctgactccacagagcacagtcttcttcctcccctcaataacttctctgttgcagaa
tgtcagctaatgaagacggagcggcctaggcccaacacatttgtgattcggtgcttacaa
tggacgacagttattgaacggacttttcatgttgacacaccagaggaaagggaagaatgg
attattgccatccagacagtggccaatggcctgaagaaccaggtacctgaagatgaagag
gaggaagccatggaagttaagtatggctcccccagtgatgtctcgagtgcagagcagatg
gacgttgcaatgtccaaagggcgccccaaagtgaccatgaatgattttgactacctcaaa
ttgctgggaaaagggacctttgggaaggttatccttgttcgagagaaagctaccggactt
tactatgctatgaagatccttcgaaaagaggtcataattgctaaggatgaagttgctcat
acactaacagaaagcagagttttgcagaacacaaaacacccgtttttaacgggattaaag
tatgcatttcagaccagtgacagactctgctttgttatggaatatgctaatggtggagag
ctttttttccacctttcacgagaacgagtttttacagaggacagagcacgcttttatggt
gcagaaattgtgtcggctttagaatatctacattctcgaaacgtagtatacagagacatt
aagctggagaatctcatgctggataaggatggccatgtcaagattacagattttggtttg
tgtaaggaaggcatcacagatggagccactatgaggactttctgtggcacaccagagtat
cttgcgcctgaggtgcttgaagataacgactatggccgagccgtggactggtggggtctc
ggagttgtgatgtatgaaatgatgtgtggccgattgcccttttataaccaagaccatgag
aggttattcgaacttatcctcatggaggagacccgctttccccgtacattaagtccagag
gcaaaatctctgcttgctgggcttttgaaaaaggatcctaaacagagattaggagggggt
cctgatgatgcccaagaggtcatgtcgcatggattctttgcttctatcaattggcaagat
gtaacggagagaaagctctcccctcctttcaagccacaagtcacatccgagattgacaca
agatattttgatgacgagtttacggctcagtctataacattgacccctcctgacagatat
gataaccttgatgccttagaatcagagcagcgccctcattttcctcaattctcttattct
tcaagcatacgggaataa

DBGET integrated database retrieval system