KEGG   Xenopus laevis (African clawed frog): 432181Help
Entry
432181            CDS       T01010                                 

Gene name
gtf2h4, gtf2h4.1, tfb2, tfiih
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    432181 (gtf2h4)
  Replication and repair
   03420 Nucleotide excision repair
    432181 (gtf2h4)
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     432181 (gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 455 aa AA seqDB search
MKLQRVHLKCKNLHEFLQELSPGVLDRLYNHPATCLAVFRELPGLAKNYVMRMLFLEQPL
PQAAVALWVKKENFNEHEENTQVLTGLRLWHTQQLPGGLQGLILNPIFRENLKIALLGGG
KAWADDGCLLGPDKHGKDVVSLDKYAEERWEVILHFMVGSPSAAVSQDLAQLLIQAGLMK
NESGEAPCISSAGFQFLLLDTPSQLWYFMLQYLKSAESRGMNLVEILSFMFQLSFSTLGK
DYSVEGMSDSLLTFLQHLREFGLVFQRKRKSRRYYPTRLAINLASGISGSVVDSHKQGFI
VVETNYRIYAYTDSELQIALIALFSEMLYRFPNLVVAQVTRENVQQAIGNGITAEQIIHF
LRTRAHPVMLQQNPALPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLRNYARD
LGVLVFENPAKRVMVVTPGGHSDVKRFWKRQKQSS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccagcgagtacatctgaagtgtaagaatttgcacgagtttcttcaggaactc
agcccaggggtgctcgatcgattgtacaaccatccagcaacttgtttggctgtgttcagg
gaactcccaggattggccaaaaattatgtgatgcgtatgctatttctggaacaacccttg
cctcaagctgctgttgcattatgggtcaagaaggaaaatttcaatgaacatgaggagaat
acacaggtcctgactgggttacgactttggcacacacaacaactccctggtgggttacag
ggcctgattctcaatccaatctttagagaaaatcttaaaatagcactgctaggcggggga
aaagcttgggcagatgatggctgcctactaggccctgataaacatggaaaagatgtggtc
tcgttggataagtatgcagaagagagatgggaggtcatattacattttatggttgggtct
ccaagtgctgctgttagccaggacttggcacaactgcttatacaggctggccttatgaaa
aatgagtctggggaagctccttgtatttcatcagctggcttccagtttttgcttttggac
acaccttctcagctctggtattttatgcttcagtatctcaaatctgcagagtctcgtgga
atgaatcttgtggaaatactctccttcatgttccagttaagcttctctactttgggaaag
gattactctgtggaagggatgagtgattccttactgacatttctacaacacctacgtgaa
tttggccttgtgtttcaaagaaagagaaagtcacgtcgatactatccaacacgtctggct
ataaaccttgcatctggtatatctggctcggttgttgacagccataagcaagggtttatt
gttgtggaaacaaactacagaatatatgcatacacagattcagagctgcaaattgccctt
attgccctgttctctgagatgttgtatcgcttcccaaatctggttgtggcacaagtcact
cgagagaatgtccagcaagcgatagggaatggcatcactgctgagcagataatccacttt
ctgaggacaagagcacatccagtgatgttgcagcagaatccagcgcttccaccaacaatt
actgaccaaataagactttgggaactcgagagagaccgcctacgtttttctgaaggtgtc
ctgtacaaccagtttctatcccaagtggactttgaacttttgagaaactatgcacgtgat
cttggagtgctcgtgtttgagaatccagccaagcgtgtgatggtagtgacccccggagga
cactctgatgttaagcgtttctggaaacgccaaaagcaaagctcctga

DBGET integrated database retrieval system