KEGG   Xenopus laevis (African clawed frog): 432295Help
Entry
432295            CDS       T01010                                 

Gene name
eif3j, eif3s1
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    432295 (eif3j)
Translation factors [BR:xla03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    432295 (eif3j)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 255 aa AA seqDB search
MAENDSWDADDFEAEDLNQKGAASGPVIVKDRWEGEDEEEDVKDNWDDEEEAQDATKQEP
QKTELKVPEKKKLQEKIKEKENLQKKRKEELKKQALESSNLPEITPEEQLAEKLRQQKLQ
EDSDLELAKEAFGVNVPVTGIDAMNPSTREDFTEFGKLLKEKITQYERSLYYPGFLEALV
RDVCLSLEVEDLKKINSSLTVLCFEKQKQEKQQTKTKKKKKGVVPGGGLKGNMKDYLEDY
GGMDEGYGREFDDFM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaacgacagctgggatgctgatgactttgaggcagaagatctaaatcaaaag
ggtgctgcgtcaggccccgtgatagtaaaggatcgctgggagggagaggatgaagaggaa
gatgttaaggataattgggacgatgaagaggaggcacaggatgcaactaaacaagagcca
cagaaaacagagctgaaggttccagaaaagaagaaattacaagaaaaaataaaagaaaaa
gagaacttgcagaaaaagaggaaggaagaactgaaaaagcaggcattggagtcttcaaac
ctaccggagatcactccagaggaacagttggcagaaaagcttcgccaacagaagttacag
gaggattctgacttagaattagcaaaggaggcttttggagtcaatgttccggttactgga
atagatgccatgaatccgtccacacgagaagactttacggaatttgggaagctccttaaa
gaaaagataacccagtatgagagatcgttatattaccctggcttcctggaggcccttgtg
cgggacgtgtgcctctcgttggaagttgaagatctcaaaaaaatcaacagttccctaaca
gtgctgtgctttgagaaacaaaagcaagagaagcagcaaactaaaaccaaaaagaaaaag
aagggagttgttccaggaggaggattaaaaggcaacatgaaggattatctagaagattat
gggggcatggatgagggctatggacgagagtttgacgatttcatgtga

DBGET integrated database retrieval system