KEGG   Xenopus laevis (African clawed frog): 432343Help
Entry
432343            CDS       T01010                                 

Gene name
cyp2c18, cpci, cyp2c, cyp2c17, p450-6b/29c, p450iic17
Definition
cytochrome P450, family 2, subfamily C, polypeptide 18 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    432343 (cyp2c18)
   00590 Arachidonic acid metabolism
    432343 (cyp2c18)
   00591 Linoleic acid metabolism
    432343 (cyp2c18)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    432343 (cyp2c18)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     432343 (cyp2c18)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP2 family
   432343 (cyp2c18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 496 aa AA seqDB search
MEILGATAGLLVICVLFLLLNTIQVIQRQGKGKLPPGPTPLPFLGNFLQLKGKEVFKSLL
ELSKKYGPVYTIHLGMEPVVVLCNCDIVKEALNDNGEEFGARGYMPLLDKMSHGGHGVIA
SNGERWKQLRRFSLITLRNFGMGKRSIEERIQEEARFLAKEFKNTKGQPVDPTFYFSKAV
SNVICSIVFGDRFEYEDKEYLRLLDFLNQTFRGVSSVWGQLYNIFPKVMGKLPGPHNTIF
QSVDVIHEFIKKRINMHKETLDPSSPRDFLDCFLIKMQQEKDVPQTEFHMLGAVNTTFDL
FGAGTETVSTTLRYGLLILLKHPDIEERIHKEIDSIIGRNRAPCIEDRSRMPYTDAVIHE
IQRFTDIIPMGLPHKLTRDIHFQGYSIPKGTTVYPMLSSVLHDPKQFKYPYSFNPGHFVD
ENGKFRKNDGFMPFSSGKRICVGEGLARMELFLFISTVLQNFTLSSPVDTDDLDLTPHLS
GFGNVPCPYKLCFIPR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagatcttgggagcaactgcagggctgcttgtaatctgtgtactattcctgctccta
aatacgatacaagttatacaacgccagggcaagggcaaactgcccccaggacccacaccc
ctgcccttcctgggcaactttctgcagctgaaaggcaaagaggttttcaaatcccttctt
gagcttagtaagaagtatggcccagtgtacaccattcatttgggcatggagccagttgtg
gttttgtgcaactgtgacattgtcaaagaggctctcaatgacaacggagaggaatttggt
gctcgtggatatatgcccctactggacaagatgtcccatggaggtcatggggttattgct
agtaatggagaacgctggaagcagctaagacgattttccctgataactttgaggaatttt
ggaatgggaaagagaagcatagaggaaagaatccaagaagaggcccgtttccttgcaaaa
gaattcaaaaacaccaaaggccagcctgtggatccaacattttactttagcaaagctgtt
tccaatgtaatctgctccatcgtatttggagaccggtttgaatatgaagataaagaatac
cttaggcttctagatttcttaaatcaaactttcagaggcgtaagttctgtttgggggcag
ttgtacaatatatttccaaaagtcatgggtaagctcccagggccccataacacaatattc
caatctgttgatgtcattcatgagtttattaagaaaaggatcaacatgcataaagagact
cttgaccctagttctcctagagattttcttgactgtttcctcataaaaatgcaacaggaa
aaggatgtgccccagactgagtttcacatgctgggtgctgttaacaccacatttgatctg
tttggtgctggaacagaaactgtcagcacaacactgcgatatggcctgctgattctcctt
aagcacccagatattgaagagcgaatccataaagagattgatagcatcattggcagaaat
cgcgctccatgtattgaagaccgttcccgcatgccatacacagatgctgttatccatgag
attcagagattcactgacattatacccatgggacttccccacaaactgacacgggacatt
cattttcagggttattccattccaaagggtaccacagtatatccaatgcttagctctgtt
ctgcatgacccaaagcagtttaaatacccttattcattcaatcctggacatttcgtagat
gaaaatggaaagtttcgtaaaaatgatggattcatgcctttttcctcagggaagagaata
tgtgttggggagggtctggctcggatggaactctttctgtttatttcaaccgtactacag
aattttacactaagttctccagtggacacagacgatttggaccttacacctcatttgagt
ggctttgggaatgttccctgtccctacaagctctgcttcattcctcgctag

DBGET integrated database retrieval system