KEGG   Xenopus laevis (African clawed frog): 432343Help
Entry
432343            CDS       T01010                                 

Gene name
cyp2c18.L, cpci, cyp2c, cyp2c17, cyp2c18, p450-6b/29c, p450iic17
Definition
(RefSeq) cytochrome P450 family 2 subfamily C member 18 L homeolog
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
8L
AA seq 496 aa AA seqDB search
MEILGATAGLLVICVLFLLLNTIQVIQRQGKGKLPPGPTPLPFLGNFLQLKGKEVFKSLL
ELSKKYGPVYTIHLGMEPVVVLCNCDIVKEALNDNGEEFGARGYMPLLDKMSHGGHGVIA
SNGERWKQLRRFSLITLRNFGMGKRSIEERIQEEARFLAKEFKNTKGQPVDPTFYFSKAV
SNVICSIVFGDRFEYEDKEYLRLLDFLNQTFRGVSSVWGQLYNIFPKVMGKLPGPHNTIF
QSVDVIHEFIKKRINMHKETLDPSSPRDFLDCFLIKMQQEKDVPQTEFHMLGAVNTTFDL
FGAGTETVSTTLRYGLLILLKHPDIEERIHKEIDSIIGRNRAPCIEDRSRMPYTDAVIHE
IQRFTDIIPMGLPHKLTRDIHFQGYSIPKGTTVYPMLSSVLHDPKQFKYPYSFNPGHFVD
ENGKFRKNDGFMPFSSGKRICVGEGLARMELFLFISTVLQNFTLSSPVDTDDLDLTPHLS
GFGNVPCPYKLCFIPR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagatcttgggagcaactgcagggctgcttgtaatctgtgtactattcctgctccta
aatacgatacaagttatacaacgccagggcaagggcaaactgcccccaggacccacaccc
ctgcccttcctgggcaactttctgcagctgaaaggcaaagaggttttcaaatcccttctt
gagcttagtaagaagtatggcccagtgtacaccattcatttgggcatggagccagttgtg
gttttgtgcaactgtgacattgtcaaagaggctctcaatgacaacggagaggaatttggt
gctcgtggatatatgcccctactggacaagatgtcccatggaggtcatggggttattgct
agtaatggagaacgctggaagcagctaagacgattttccctgataactttgaggaatttt
ggaatgggaaagagaagcatagaggaaagaatccaagaagaggcccgtttccttgcaaaa
gaattcaaaaacaccaaaggccagcctgtggatccaacattttactttagcaaagctgtt
tccaatgtaatctgctccatcgtatttggagaccggtttgaatatgaagataaagaatac
cttaggcttctagatttcttaaatcaaactttcagaggcgtaagttctgtttgggggcag
ttgtacaatatatttccaaaagtcatgggtaagctcccagggccccataacacaatattc
caatctgttgatgtcattcatgagtttattaagaaaaggatcaacatgcataaagagact
cttgaccctagttctcctagagattttcttgactgtttcctcataaaaatgcaacaggaa
aaggatgtgccccagactgagtttcacatgctgggtgctgttaacaccacatttgatctg
tttggtgctggaacagaaactgtcagcacaacactgcgatatggcctgctgattctcctt
aagcacccagatattgaagagcgaatccataaagagattgatagcatcattggcagaaat
cgcgctccatgtattgaagaccgttcccgcatgccatacacagatgctgttatccatgag
attcagagattcactgacattatacccatgggacttccccacaaactgacacgggacatt
cattttcagggttattccattccaaagggtaccacagtatatccaatgcttagctctgtt
ctgcatgacccaaagcagtttaaatacccttattcattcaatcctggacatttcgtagat
gaaaatggaaagtttcgtaaaaatgatggattcatgcctttttcctcagggaagagaata
tgtgttggggagggtctggctcggatggaactctttctgtttatttcaaccgtactacag
aattttacactaagttctccagtggacacagacgatttggaccttacacctcatttgagt
ggctttgggaatgttccctgtccctacaagctctgcttcattcctcgctag

DBGET integrated database retrieval system