KEGG   Xenopus laevis (African clawed frog): 432347Help
Entry
432347            CDS       T01010                                 

Definition
uncharacterized protein MGC82264
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    432347
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     432347
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP2 family
   432347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MDTAWLWTLLLTLLISCMLIYSTWTKMYRNSNLPPGPTPIPLFGNVLQIKRGEMVKSLLE
LRKIYGPVYTLYFGPSPVIILCDYQSIKEALNDQAEEFSGRGKIPSWDQYFQGYGEAFTN
GEEWKQLRRFSLTTLRNFGMGKKGIEERIQEEAQFLVEEIKSYKEKSFDPAKLLVQCVSN
VICSVVFGKRYEYSNKDFHELLYMFQAVFEDTSSSWGQLMTMLPIIMKHIPGPHRRVLHE
LNRVNDFILQRVNENEKTLDPKSPRNFIDSFLIQMQQEKENPMTKFHRKNLICTIMNLFF
AGTETVSTTLRHGFLILLIHPEIEVKLHEEIDRVIGQGRCPTMEDKSKMPYTDAVIHEIQ
RVSDVIPMSLPHSVMKDTQLRGYTIPKGTDVYPMICTALRDPKQFATPNKFNPQHFLDDK
GNFKTSNAFMPFSTGKRICLGEGLARMELFLFLTNILQNFKLHSEKQFTEDDIAPKMQGF
ANYPLFYEFSLIPRI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggatacagcatggttgtggaccttgctgctaactctgctcatctcctgcatgttaatc
tattctacctggaccaaaatgtatagaaacagtaacctccctccaggacccacgcctatc
cctctgtttggaaatgttctgcagatcaagaggggagagatggtaaaatcattactagag
cttagaaagatatatggccctgtatacaccctctactttggccccagtcctgttataatc
ctgtgtgattaccagtcaataaaagaagccttaaatgaccaagcagaagaattcagtggt
cgtgggaaaataccttcttgggatcaatattttcaaggatatggggaagctttcactaat
ggagaagaatggaagcaactgcgacgcttctcacttacaacacttaggaactttggtatg
ggaaagaagggcatagaagaaaggatacaagaagaagcgcagttcctagtggaagagatt
aaatcatacaaagaaaaatcttttgacccagccaaactcttagtccaatgtgtgtccaat
gttatctgctctgttgttttcggaaaacggtatgaatactccaacaaagatttccatgaa
ctgctgtatatgtttcaagctgtatttgaagatacaagttcctcctggggtcagctgatg
accatgttgccgattataatgaagcatattccaggccctcacaggagagtattacatgaa
ttgaatagagttaatgatttcattttacaaagagtgaacgagaacgagaagacgttggat
cccaaatcaccaagaaacttcattgacagtttcctcatccaaatgcagcaggagaaggaa
aatcctatgaccaaattccacaggaagaatttgatatgcactattatgaacctcttcttt
gctgggacagagacagttagtacaaccttaagacatggatttcttatactactgatacat
cctgaaatagaagtaaagctgcatgaggaaatagaccgcgtgattggacaaggacgttgc
ccaactatggaggataagagcaagatgccttacacagatgctgtgatccatgaaatacag
agagttagtgatgtaatccctatgagtcttccacattcagtaatgaaagacacacaactc
agaggctacacaattcccaagggtactgatgtctaccccatgatctgtactgctctgcga
gatcctaaacaatttgctactcccaataagtttaatcctcagcacttcttggatgacaag
ggcaacttcaagaccagcaatgccttcatgccattttccacaggaaagcggatctgcctt
ggggaaggtttggctcgaatggaactctttctttttttaaccaacattctacagaacttc
aagctacattcagaaaagcaattcacagaagatgacattgctccaaaaatgcagggcttt
gccaattatccactcttttatgaattttcacttattccacgtatataa

DBGET integrated database retrieval system