KEGG   Xenopus laevis (African clawed frog): 432347Help
Entry
432347            CDS       T01010                                 

Gene name
cyp2f2.L
Definition
(RefSeq) Cyp2f2 protein L homeolog
  KO
K07417  
cytochrome P450 family 2 subfamily G
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP2 family
   432347 (cyp2f2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
8L
AA seq 495 aa AA seqDB search
MDTAWLWTLLLTLLISCMLIYSTWTKMYRNSNLPPGPTPIPLFGNVLQIKRGEMVKSLLE
LRKIYGPVYTLYFGPSPVIILCDYQSIKEALNDQAEEFSGRGKIPSWDQYFQGYGEAFTN
GEEWKQLRRFSLTTLRNFGMGKKGIEERIQEEAQFLVEEIKSYKEKSFDPAKLLVQCVSN
VICSVVFGKRYEYSNKDFHELLYMFQAVFEDTSSSWGQLMTMLPIIMKHIPGPHRRVLHE
LNRVNDFILQRVNENEKTLDPKSPRNFIDSFLIQMQQEKENPMTKFHRKNLICTIMNLFF
AGTETVSTTLRHGFLILLIHPEIEVKLHEEIDRVIGQGRCPTMEDKSKMPYTDAVIHEIQ
RVSDVIPMSLPHSVMKDTQLRGYTIPKGTDVYPMICTALRDPKQFATPNKFNPQHFLDDK
GNFKTSNAFMPFSTGKRICLGEGLARMELFLFLTNILQNFKLHSEKQFTEDDIAPKMQGF
ANYPLFYEFSLIPRI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggatacagcatggttgtggaccttgctgctaactctgctcatctcctgcatgttaatc
tattctacctggaccaaaatgtatagaaacagtaacctccctccaggacccacgcctatc
cctctgtttggaaatgttctgcagatcaagaggggagagatggtaaaatcattactagag
cttagaaagatatatggccctgtatacaccctctactttggccccagtcctgttataatc
ctgtgtgattaccagtcaataaaagaagccttaaatgaccaagcagaagaattcagtggt
cgtgggaaaataccttcttgggatcaatattttcaaggatatggggaagctttcactaat
ggagaagaatggaagcaactgcgacgcttctcacttacaacacttaggaactttggtatg
ggaaagaagggcatagaagaaaggatacaagaagaagcgcagttcctagtggaagagatt
aaatcatacaaagaaaaatcttttgacccagccaaactcttagtccaatgtgtgtccaat
gttatctgctctgttgttttcggaaaacggtatgaatactccaacaaagatttccatgaa
ctgctgtatatgtttcaagctgtatttgaagatacaagttcctcctggggtcagctgatg
accatgttgccgattataatgaagcatattccaggccctcacaggagagtattacatgaa
ttgaatagagttaatgatttcattttacaaagagtgaacgagaacgagaagacgttggat
cccaaatcaccaagaaacttcattgacagtttcctcatccaaatgcagcaggagaaggaa
aatcctatgaccaaattccacaggaagaatttgatatgcactattatgaacctcttcttt
gctgggacagagacagttagtacaaccttaagacatggatttcttatactactgatacat
cctgaaatagaagtaaagctgcatgaggaaatagaccgcgtgattggacaaggacgttgc
ccaactatggaggataagagcaagatgccttacacagatgctgtgatccatgaaatacag
agagttagtgatgtaatccctatgagtcttccacattcagtaatgaaagacacacaactc
agaggctacacaattcccaagggtactgatgtctaccccatgatctgtactgctctgcga
gatcctaaacaatttgctactcccaataagtttaatcctcagcacttcttggatgacaag
ggcaacttcaagaccagcaatgccttcatgccattttccacaggaaagcggatctgcctt
ggggaaggtttggctcgaatggaactctttctttttttaaccaacattctacagaacttc
aagctacattcagaaaagcaattcacagaagatgacattgctccaaaaatgcagggcttt
gccaattatccactcttttatgaattttcacttattccacgtatataa

DBGET integrated database retrieval system