KEGG   Xenopus laevis (African clawed frog): 443786Help
Entry
443786            CDS       T01010                                 

Gene name
xrcc4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    443786 (xrcc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 362 aa AA seqDB search
MEKKIRSICISSYPGAIYFLQIAWKKDLGDGFTVALTDGHSAWTGEVSQEDVSQEAKDME
MERSNYVEELRKALIMTALPANKYNFDLLEDRENPEIYHFTYEKTLKEVAFKLGSTKLKS
VQNPAHVIKELISYCLGCTAELYSRNEHLQKENERLQCDWNDMHAQLEKFVDGKEELEQT
LYTQFTCVLNEKKAKIRNLKEKLSEAQERLKQKSEDSAPVDTLAASEMKYDAFGGSTDEE
QESPAVASKTGKEHLLSRVLCCINACPSSGLVSKSNPAAKSQRRSLVIDDAPDVAPSRKR
RQRGQKTFYTDVVANTTKTSNEETQRCNPAPAQSVGKTFSTEGTSSQTLKNTPDPDDLFS
DI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaaataagaagtatctgcatatcatcatacccaggagcaatatattttctt
cagattgcctggaagaaagatttgggagatggattcacagtagcactcactgatggtcac
tctgcctggactggtgaggtttctcaagaagatgtttcccaagaagcaaaagacatggag
atggagaggtcaaactatgttgaggaattaaggaaagctttgattatgacagccttacca
gcaaataaatataattttgatctgttggaagatagagaaaaccctgaaatctatcatttc
acatatgagaagacattaaaagaagttgcgtttaagcttggatcaactaaactgaaatct
gtccagaacccggcacatgtcatcaaagagttgataagctattgcctgggctgtacagct
gaattatatagcagaaatgaacacctgcaaaaggaaaatgaaaggctccagtgtgactgg
aatgacatgcacgcacagctggaaaagtttgtggatggcaaagaagaactagagcaaacc
ctttatactcaatttacttgtgttctaaatgagaagaaagcaaaaatcagaaacctaaag
gaaaaattatcagaggcacaagaaagactaaaacaaaaaagtgaagattctgctcccgtt
gatactcttgcagccagtgaaatgaagtatgatgcctttggtggctcaactgatgaggag
caggaaagccctgcagttgcctcaaagactggcaaagaacatttactgagccgtgtgctg
tgctgtattaatgcttgcccttcttcaggcctggtgtccaagtcgaaccctgctgccaaa
tcccagcgaagatcactcgtcattgacgatgcccctgatgttgcacctagtagaaaacga
agacagaggggccagaagactttctacactgatgtagtagctaatactactaaaacatct
aatgaagaaacacagagatgtaatccagccccagctcagtcagttggcaaaactttctca
acagaaggaacttcttcccagacattaaaaaacactcccgatccagatgacctcttcagt
gacatttaa

DBGET integrated database retrieval system