KEGG   Xenopus laevis (African clawed frog): 443801Help
Entry
443801            CDS       T01010                                 

Gene name
chp1, chp
Definition
calcineurin-like EF-hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     443801 (chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 193 aa AA seqDB search
MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFTEGEDQVNFRGFMRTLAHFRPIEDNSKDANSQEPLNSRSNKLLFAFRLY
DLDKDDKISREELLQVLRMMVGVNISDDQLGSIADRTIQEADQDGDSAISFTEFVKVLEK
VDVEQKMSIRFLH
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggctccagggcgtcaacgctgctcagggatgaggagatagaagagattaagaaggag
acgggtttttctcacagccagataactcgattgtacagtcggttcacaagcctggataaa
ggagagaatgggactttgagtcgagaagatttccagcggataccagagttggcgattaac
ccccttggagacaggattatcaatgctttctttactgaaggagaggaccaggtgaatttc
cgaggctttatgaggactttggcacacttccgccctattgaagataattccaaagatgca
aacagccaagagccactaaacagcagaagcaacaaattgttatttgcattccgtctctat
gacttggacaaagatgacaagatctccagggaggaactattacaggtgctgcgtatgatg
gtgggtgtgaacatatcggatgatcagctgggcagcattgctgaccgtactattcaggaa
gctgaccaagatggagacagtgctatatcattcacagagtttgttaaggttttagaaaaa
gttgatgtagagcagaaaatgagcattagattcctacactga

DBGET integrated database retrieval system