KEGG   Xenopus laevis (African clawed frog): 443819Help
Entry
443819            CDS       T01010                                 

Gene name
rpa2.L, repa2, rpa2, rpa2-a, rpa32, rpa34
Definition
(RefSeq) replication protein A2 L homeolog
  KO
K10739  
replication factor A2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    443819 (rpa2.L)
   03420 Nucleotide excision repair
    443819 (rpa2.L)
   03430 Mismatch repair
    443819 (rpa2.L)
   03440 Homologous recombination
    443819 (rpa2.L)
   03460 Fanconi anemia pathway
    443819 (rpa2.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    443819 (rpa2.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     443819 (rpa2.L)
   MMR (mismatch exicision repair)
     443819 (rpa2.L)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     443819 (rpa2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 276 aa AA seqDB search
MWNNHGGFDGGYGGSGMGGGGGYMQSPGGFGSPAPTQGEKKSRSRSQQIVPCTVSQLLSA
TQNDEVFRIGEAELSQVTIVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEASCEN
MVVPPGSYVKVAGHLRSFQNKKSVVAFKIAPVEDMNEFVSHMLEVVHAHMAMNSQGAPSG
GGSTVALSTPGRVGDSGRAFSGGNDNPTNGLTPHQSQILSLIKSCKGNEGMAFEELKNRL
HGMNVNTIRQAVEFLSNEGHIYSTIDDEHYKCTDGD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacaaccacggtggatttgatggagggtatggtggctcaggaatgggaggagga
ggaggttatatgcagtctccaggaggctttgggtctcctgcacctactcaaggagagaaa
aaatcgaggtccagatcacagcaaattgtgccatgtacagtgtcacagctactgtcggca
acacagaatgatgaggtgtttcgaataggagaagctgaactttcacaggtcactatagtt
ggcattgtcagacatgcagaaaaagctccaacaaatattctttacaaagtggatgatatg
actgcagcacccatggatgtcagacagtgggttgacacagatgaggcaagttgtgaaaat
atggtggtacctccagggagttacgtaaaagtagctggtcaccttcgttctttccagaac
aagaaaagtgttgtagcatttaagattgctcctgttgaagatatgaatgagtttgtttct
catatgctggaagttgttcacgctcacatggccatgaattcccagggtgcgccttcaggg
ggtggatctacagtggccctcagtacacctggacgcgttggtgacagtggcagagcattc
tcaggaggaaatgacaatccgacaaatgggctgacaccacatcagagccagattcttagt
ttgatcaaaagctgcaaaggaaatgaaggcatggcatttgaagaactcaaaaatcgactt
catggaatgaatgttaacacaattaggcaagctgtggaatttctcagcaatgaaggacac
atttattccactattgatgatgaacattacaaatgcactgatggagattaa

DBGET integrated database retrieval system