KEGG   Xenopus laevis (African clawed frog): 443852Help
Entry
443852            CDS       T01010                                 

Gene name
ppp1cb.L, ppp1cb, ppp1cb.S
Definition
(RefSeq) protein phosphatase 1, catalytic subunit, beta isozyme L homeolog
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03015  mRNA surveillance pathway
xla04114  Oocyte meiosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04270  Vascular smooth muscle contraction
xla04510  Focal adhesion
xla04810  Regulation of actin cytoskeleton
xla04910  Insulin signaling pathway
xla05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    443852 (ppp1cb.L)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    443852 (ppp1cb.L)
   04218 Cellular senescence
    443852 (ppp1cb.L)
  Cellular community - eukaryotes
   04510 Focal adhesion
    443852 (ppp1cb.L)
  Cell motility
   04810 Regulation of actin cytoskeleton
    443852 (ppp1cb.L)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    443852 (ppp1cb.L)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    443852 (ppp1cb.L)
   04270 Vascular smooth muscle contraction
    443852 (ppp1cb.L)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    443852 (ppp1cb.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     443852 (ppp1cb.L)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     443852 (ppp1cb.L)
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     443852 (ppp1cb.L)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     443852 (ppp1cb.L)
Spliceosome [BR:xla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    443852 (ppp1cb.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 443852
NCBI-ProteinID: NP_001085426
Xenbase: XB-GENE-961676
UniProt: Q6GQL2 A0A1L8G146
Position
5L
AA seq 327 aa AA seqDB search
MADGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggagagctgaacgtggacagtctgatcagccgattactggaggtacgagga
tgtcgcccggggaagattgtgcagatgacagaggcagaagtgcgagggctctgtataaag
tctcgtgagatcttcctgagtcaaccaatcctgttggagttggaagccccattgaagatc
tgcggtgatatccatggacagtacacagatttactgcggttgtttgaatatggtggcttt
ccgccagaagccaattacctcttcctgggggattatgtggacagagggaagcagtcgctg
gaaaccatctgcctgctgctggcatataaaatcaaatatccagaaaatttcttccttctc
agaggaaaccatgagtgtgcgagcatcaaccggatctacggcttctatgatgaatgcaaa
cggagatttaacataaaactttggaagacttttacagactgcttcaattgcctgcctatt
gctgccattgtggatgaaaagattttctgttgccatggaggtctatcaccagatctccag
tccatggaacaaatccgcagaatcatgagaccaacagatgttccagacaccgggttgctc
tgtgacttactgtggtcggatccagataaagatgtccaaggctggggcgagaatgatcgt
ggcgtttccttcacattcggggcagacgtcgttagtaaattcctgaatcgccacgatcta
gatctgatctgtcgggcccatcaggtggtagaagatgggtatgaattctttgccaagcgt
cagctggtcaccctcttctctgctccaaattactgtggcgagtttgataatgctgggggc
atgatgagtgtcgacgagaccctaatgtgctcttttcagattttgaaaccatccgaaaag
aaagcaaaataccaatacgggggattgaactctggccgcccagtgacgcctcctcggaca
gccaatcctccaaagaagaggtga

DBGET integrated database retrieval system