KEGG   Xenopus laevis (African clawed frog): 443852Help
Entry
443852            CDS       T01010                                 

Gene name
ppp1cb
Definition
protein phosphatase 1, catalytic subunit, beta isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:xla03015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xla04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xla04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xla04270]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xla05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 327 aa AA seqDB search
MADGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggagagctgaacgtggacagtctgatcagccgattactggaggtacgagga
tgtcgcccggggaagattgtgcagatgacagaggcagaagtgcgagggctctgtataaag
tctcgtgagatcttcctgagtcaaccaatcctgttggagttggaagccccattgaagatc
tgcggtgatatccatggacagtacacagatttactgcggttgtttgaatatggtggcttt
ccgccagaagccaattacctcttcctgggggattatgtggacagagggaagcagtcgctg
gaaaccatctgcctgctgctggcatataaaatcaaatatccagaaaatttcttccttctc
agaggaaaccatgagtgtgcgagcatcaaccggatctacggcttctatgatgaatgcaaa
cggagatttaacataaaactttggaagacttttacagactgcttcaattgcctgcctatt
gctgccattgtggatgaaaagattttctgttgccatggaggtctatcaccagatctccag
tccatggaacaaatccgcagaatcatgagaccaacagatgttccagacaccgggttgctc
tgtgacttactgtggtcggatccagataaagatgtccaaggctggggcgagaatgatcgt
ggcgtttccttcacattcggggcagacgtcgttagtaaattcctgaatcgccacgatcta
gatctgatctgtcgggcccatcaggtggtagaagatgggtatgaattctttgccaagcgt
cagctggtcaccctcttctctgctccaaattactgtggcgagtttgataatgctgggggc
atgatgagtgtcgacgagaccctaatgtgctcttttcagattttgaaaccatccgaaaag
aaagcaaaataccaatacgggggattgaactctggccgcccagtgacgcctcctcggaca
gccaatcctccaaagaagaggtga

DBGET integrated database retrieval system