KEGG   Xenopus laevis (African clawed frog): 443888Help
Entry
443888            CDS       T01010                                 

Gene name
cyct-a, cycs-a
Definition
cytochrome c, testis
Orthology
K08738  
cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    443888 (cyct-a)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    443888 (cyct-a)
   04115 p53 signaling pathway
    443888 (cyct-a)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    443888 (cyct-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 105 aa AA seqDB search
MGDAEKGKKIFIQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW
GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERLDLIAYLKKSTSE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgctgaaaagggaaagaagatctttatccagaagtgtgctcagtgccacaca
gttgaaaagactgggaaacacaagactgggcctaacttatggggtctcttcggccggaaa
actggacaagccccgggattttcttacactgatgcaaacaaaagcaaaggcattgtctgg
ggagaggatacgctgtttgaatatttggaaaacccaaagaaatatattccaggaaccaaa
atgatttttgctggcataaaaaagaagaacgagcgcttagatttgattgcctacttaaag
aagtccacatcagagtga

DBGET integrated database retrieval system