KEGG   Xenopus laevis (African clawed frog): 443888Help
Entry
443888            CDS       T01010                                 

Gene name
cyct.L, cycs-a, cyct, cyct-a, cyct-b
Definition
(RefSeq) cytochrome c, testis L homeolog
  KO
K08738  
cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    443888 (cyct.L)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    443888 (cyct.L)
   04115 p53 signaling pathway
    443888 (cyct.L)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    443888 (cyct.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
9_10S
AA seq 105 aa AA seqDB search
MGDAEKGKKIFIQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW
GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERLDLIAYLKKSTSE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgctgaaaagggaaagaagatctttatccagaagtgtgctcagtgccacaca
gttgaaaagactgggaaacacaagactgggcctaacttatggggtctcttcggccggaaa
actggacaagccccgggattttcttacactgatgcaaacaaaagcaaaggcattgtctgg
ggagaggatacgctgtttgaatatttggaaaacccaaagaaatatattccaggaaccaaa
atgatttttgctggcataaaaaagaagaacgagcgcttagatttgattgcctacttaaag
aagtccacatcagagtga

DBGET integrated database retrieval system