KEGG   Xenopus laevis (African clawed frog): 443964Help
Entry
443964            CDS       T01010                                 

Definition
MGC80357 protein
Orthology
K02649  
phosphoinositide-3-kinase, regulatory subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    443964
   04370 VEGF signaling pathway
    443964
   04630 Jak-STAT signaling pathway
    443964
   04068 FoxO signaling pathway
    443964
   04070 Phosphatidylinositol signaling system
    443964
   04150 mTOR signaling pathway
    443964
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    443964
  Cell growth and death
   04210 Apoptosis
    443964
  Cell communication
   04510 Focal adhesion
    443964
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    443964
  Endocrine system
   04910 Insulin signaling pathway
    443964
   04914 Progesterone-mediated oocyte maturation
    443964
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    443964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 722 aa AA seqDB search
MSGEGYQYRALYPYKKEREEDIDLRVGDILTVSRATLLPLGCYAEGMEARPEQIGWLNGC
NENTGQRGDFPGTYVEYLGRKRISPPTPKPRPPRPLPVAPGAARGESETQAFTLPDLTEQ
FSPPDTAPPLLIKLIEAIEKKGLESATLYRSQSSSSLTELRQILEYDAASVDFEQFDIAI
LSDALKRYLLDLPNPVIPALMYSEMLSAARESISSEEYVQLLRKIIRCANVPQHYWLTLQ
YLLKHFFQLCQSASKNLLSAKSLAEIFSPLLFRIQVSSSDGSEFSTQILEVLITSEWNEK
QAAPALPPKPPKSTAVTNNGTNHIMSLQDAEWYWGDISREEVNEKLRDTTDGTFLVRDAS
TIMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELITHYRNESLAQYNPKLD
VKLLYPVSKLQQDQVVKEDSIEAVGKKLREYNVQFQEKNQEYDRLYEDYTRTSQEIQMKR
TAIEAFNETIKIFEEQCQTQEKYSKEYIEKFRREGNEKEIQRILHNHEKLKSRISEIVDS
KRRLEEDLKKQTAENREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGSD
NTEDQYSVVEDEDLPHQDERTWNVGNINRNQAENLLRGKRDGTFLVRESSKAGCYACSVM
ADGEVKHCVINKTHTGFGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVTLAHPVYAQQ
RR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggagggataccagtaccgggccctgtacccgtacaagaaggagcgggaggag
gacatcgacctgcgcgtgggagacattctcacagtgagccgtgccacgctgctgcctctg
ggctgctatgcggagggaatggaggcccggcccgagcagatcggttggctcaatggatgc
aacgagaacaccgggcagcgaggggacttcccaggcacctacgtggagtatcttggtagg
aagaggatcagccctccgacccccaaaccgaggccccctcgtccgctgcctgtggctccc
ggggcggcgcgtggggaatcagagacacaggcttttacacttcccgacctgaccgaacag
ttctcaccacctgatacagcccctccgctccttatcaagctcatagaagccattgaaaag
aaaggtctcgagtctgcaacattatacagatcccaaagttccagcagcttgactgaactg
agacagattctagagtatgatgctgcttcagtggatttcgagcagtttgacatagcaatt
ctatcagatgctttaaagcgctaccttttggatctgccaaatcctgtcattccagcttta
atgtacagtgaaatgctctctgctgccagagagtccataagctccgaggaatatgtgcag
ctattgaggaagatcatccgatgtgccaacgttccacagcactactggctcacccttcag
tatctgctcaaacatttctttcaactctgtcaaagcgccagcaagaacttactgagtgcc
aagtcgctggcagaaatcttcagccccctgcttttcaggatccaggtatccagttccgac
ggctcggaattcagcactcagatactggaagttctgatcacaagcgagtggaatgagaag
caagctgctccagcactgccaccaaagcctcccaaatctactgctgtaacaaacaacggt
acaaatcacattatgtctctgcaagatgctgaatggtactggggagatatttcaagggaa
gaggtgaatgaaaagctgcgtgataccactgatggaacctttctggtacgagacgcctca
acaataatgcatggcgactacaccctaactctaaggaaaggtggaaataacaaacttatc
aaaatcttccaccgggatggaaaatacggtttttctgatcccctgactttcaactctgtg
gtcgaactgattacccactaccgaaatgagtcgcttgcccagtataaccctaaactggac
gtcaaactcctgtatcccgtgtcaaagttgcaacaggatcaggtagtcaaggaagacagc
atcgaagcagtggggaagaagctacgagagtacaatgttcagttccaagagaagaatcaa
gaatatgatcgactatatgaagactacactaggacgtctcaggaaattcaaatgaaaaga
actgcaattgaagcattcaatgagaccataaagatattcgaagaacagtgccaaacacag
gaaaaatacagcaaggagtacattgaaaaattcagacgtgaaggcaatgagaaagagata
caaaggatcttgcataatcatgaaaagctgaagtcccgcatcagtgaaatcgtcgacagc
aagagaaggctagaagaagatttgaagaaacaaacggctgaaaatcgggagattgataag
cgaatgaacagcatcaaaccagatttgattcagctgaggaagacaagagaccagtactta
atgtggttgacacaaaaaggcgtgagacagaagaaattgaacgagtggctgggcagcgat
aacactgaagatcaatattcagtggtagaggacgaggacttgccacatcaagacgagagg
acgtggaatgttggcaacatcaacagaaaccaagcagaaaaccttttacgtgggaaacgg
gacggaacattccttgtgcgagagagcagcaaagcggggtgctacgcatgctctgtaatg
gcagacggagaggtaaagcactgcgttataaacaaaactcatacgggttttgggtttgca
gaaccatacaacttgtacagctctctgaaggaactggtgctacattaccaacaaacgtcg
ctcgtacagcacaatgactctctgaatgtgacactagcacaccctgtatatgcacagcaa
aggcgatga

DBGET integrated database retrieval system