KEGG   Xenopus laevis (African clawed frog): 443994Help
Entry
443994            CDS       T01010                                 

Gene name
cdc27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    443994 (cdc27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    443994 (cdc27)
   04114 Oocyte meiosis
    443994 (cdc27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    443994 (cdc27)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     443994 (cdc27)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     443994 (cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 833 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKAHSCTTPQCKYLLAKCCVDLGKLAEGEQILSGGVLNKQKSQEEIVTEFGDSACFTLSL
LGHVYCKTDRLAKGAECYQKSLSLNPFLWSPFESLCEIGEKPDAEQTFKLTSLQSFSNCV
PNTCTMTVNTHSVVQHRQPDTVLMETPQDTIELNRLNLESSNIKYPLNSDSSISYIDPGV
ISPDSLPLGTGNAILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
SYNSSCVLDVPSSGAPTKKSVARISQAGTKSVFSQSGNSRDVTPVLLVQTQGSGPQTSTT
PQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKMPNRKTKSKTSKGGGT
QTNLNDSLEISKLDSSIISEGKISSVAPQIQALTIQKAAAEGLMSLLRDMGKGYVALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYLQAERVFSEVRRIESYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPG
YAYAFTLLGHEFVLTEELDKALACFRNSIRVNSRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSDKALDTLNKAISIDPKNPLCKFHRASILFANEKY
KLALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEAVTQEEQISECYPYESVATDESQESSMTDADDTQLHAAESDEF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacagtactgcaggaacccgtccaggctgctatatggcaagcactgaatcactacgca
tacagagatgcagtattcttggcagaaagactctacgcagaagtgcattcggaagaggct
ttatttctgctagccacctgctattaccgctcaggaaaagcttacaaggcatatcgtctc
ctgaaagcccacagttgtaccactccacaatgtaaatatcttcttgctaagtgctgcgtt
gacctcggcaagctagctgagggagagcagatcttgtcgggtggagtgctcaataaacag
aagagtcaagaggagattgttacagagtttggagactccgcctgctttacgttgtccttg
cttggccatgtatattgcaaaacagatcgattggccaaaggagcagaatgttaccaaaag
agccttagtttaaatcctttcctgtggtccccatttgagtctctgtgtgaaataggtgaa
aagccagacgccgagcagacgttcaaactgacctctctccagagcttcagcaactgcgtg
cccaacacttgcacaatgacagtcaacacacacagcgtcgtacaacatcggcagcctgat
acagtgttaatggagacaccgcaagacactatagagcttaacagactgaacctggagtca
tccaacataaaatatcccttgaacagcgattcctcaatatcctacatcgatcctggtgtt
atttcccccgattccttgccccttggtactggaaacgccattctgtccaaacaggtccaa
aataaaccaaagactggccgcagcctattgggaggaccagcagcactgagcccactcact
ccaagttttggaattctgcctctagaaacccccagcccaggagatgggtcatatttacaa
agctacaactcctcctgtgtccttgatgtgccgtcatctggtgccccaacaaaaaagtct
gttgctagaatcagccaagcaggaacaaagtctgtattttctcagagcggtaacagccgg
gatgtcaccccagttctccttgtacagactcagggctctggtccgcaaacaagcaccact
cctcaggtactgagtccaaccatagccgctccacctaatgcactgccgcgccgtagttct
cggctttttaccagtgacagctccaccaccaaggaaaacagcaaaaagctaaaaatgaag
tttccaccgaaaatgccaaatcgaaagaccaaaagtaaaacgagtaaaggcggcgggacc
cagaccaacctgaatgacagcctggagattagtaaattggattcttccattatctctgag
ggcaaaatctccagcgtggccccccaaatccaggcacttacaatacagaaggcagcggca
gaaggtttgatgagtctcctaagggacatggggaagggctacgtggccttgtgctcttac
aactgcaaggaggctataaatatactgagccatctcccgtctcatcactacaacaccggc
tgggtcttgtgccagattggccgtgcctattttgagcttgcggaataccttcaggctgaa
agagtgttctctgaggtgcggcgaattgagagctatcgagtagaaggcatggagatctac
tcaactactttgtggcatttgcagaaggatgtggccttgtctgtgctttccaaggacctg
accgacatggacaagaactctccagaggcttggtgcgccgctggaaactgctttagttta
caaagggaacatgacattgcaatcaagttcttccagagggccattcaggtggatccaggt
tatgcctacgcttttactctactcggacacgagtttgtcctgacagaggagctggacaaa
gctttggcgtgtttcagaaattccatacgagtcaactccagacactacaatgcctggtac
ggacttggaatgatttactacaagcaagagaagttcagcttggcagaaatgcattttcag
aaagcactggatattaacccccagagttctgtgttgctgtgtcatattggagtggtgcag
catgccctcaagaagtctgacaaggctttggacacacttaacaaagccatctccatagac
cccaaaaaccctctatgcaagttccatcgagcctccattctctttgccaatgagaagtac
aagttggcactgcaagaattggaggagctgaagcagattgtacctaaggaatccttggtg
tactttttaataggaaaggtatacaagaagttaggacagacacatttggcgcttatgaat
ttttcctgggccatggacctggaccccaaaggtgctaacaaccagatcaaagaggccatc
gacaaacggtacctgccagatgatgaggaggccgtgacccaagaggagcagatcagcgag
tgttacccttatgaatcagtggccactgatgaatcgcaggagagcagtatgacagacgca
gacgacacacagttgcacgctgctgaaagtgacgaattttaa

DBGET integrated database retrieval system