KEGG   Xenopus laevis (African clawed frog): 444018Help
Entry
444018            CDS       T01010                                 

Gene name
sirt6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     444018 (sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 331 aa AA seqDB search
MSVNYAAGLSPYADKGRCGLPEQFDSPDELRQKVEELAEMIRESSYVVFHTGAGISTSCG
IPDFRGPNGVWTLEEKGLDPKFDTTFETACPSPTHMALLKLQRVGILKFLVSQNVDGLHV
RSGFPREQLAELHGNMFVEECSKCAKQYVRDQVVGTMGLKPTGRFCDVPKVRGLRACRGK
LKDTILDWEDSLPDRDLNLADEACRKADLSITLGTSLQIRPSGNLPLLTKRKGGKLVIVN
LQPTKHDKHADLRIHGYVDEVMIQLMELLGHKIPVWTGIHTKTEPTYENHKEEDNSYHNS
VLDANLDQKREGCKEESNLELKKAKVEPACV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaactatgcggccggtttgtctccgtatgccgataaaggtcgctgcgggctc
ccggagcaatttgattccccggacgaattgcgtcagaaagtagaggaactagctgaaatg
atacgtgaatcctcctacgttgtttttcacacgggagccgggatcagtacttcctgcgga
atcccagacttcagggggcctaatggagtgtggactctggaggagaaagggctggaccca
aagtttgacaccacctttgaaaccgcatgtccttcccctactcacatggcgctgctgaag
ctgcagagggttgggatcctgaagtttctggttagtcaaaatgtagatggtctgcacgta
agatccggcttcccccgggagcagctggcggaactgcatgggaacatgttcgtggaggaa
tgtagcaaatgtgctaaacagtatgtgcgggatcaagtggtgggaaccatggggctcaaa
cctaccggcaggttttgtgatgtgccaaaggtgcgaggcctgcgagcttgcagggggaaa
ctgaaagacaccatcctggattgggaagactccctgcctgacagagacctaaacctggct
gatgaagcctgcaggaaagcagacctgtccattactttggggacctcactccagatccga
cccagtgggaaccttccgctcctcaccaagcgcaagggagggaaactagtcattgtaaac
cttcagcccaccaagcatgacaaacatgcggatttgagaatacatggttatgtggatgag
gtgatgatacagctcatggagcttctgggtcacaagataccagtttggactgggatacat
actaaaacagagccaacttatgagaaccataaggaggaagataactcctaccataattca
gtgctggatgctaacctggaccaaaagagggaagggtgcaaggaagaatctaatcttgag
ctaaagaaggcaaaagttgaaccagcatgtgtatga

DBGET integrated database retrieval system