KEGG   Xenopus laevis (African clawed frog): 444024Help
Entry
444024            CDS       T01010                                 

Gene name
hsp90aa1.1, hsp86, hsp89, hsp90, hsp90a, hspc1, hspca, hspn, lap2
Definition
heat shock protein 90kDa alpha (cytosolic), class A member 1, gene 1
Orthology
K04079  
molecular chaperone HtpG
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
NOD-like receptor signaling pathway
Progesterone-mediated oocyte maturation
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xla04141]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:xla04621]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 729 aa AA seqDB search
MPDEVQTATQEQQMEEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKI
RYESLTDPSKLDSGKELKIELIPNKQDRSLTIIDTGIGMTKADLINNLGTIAKSGTKAFM
EALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHIDDEQYAWESSAGGSFTVRVDNSEP
LGRGTKVILHLKEDQSEYFEEKRIKEIVKKHSQFIGYPITLFVEKERDKEISDDEAEEEK
EEKKDEPKDEEKPEIEDVGSDDEEDKKEGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDD
ITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKL
YVRRVFIMDNCDELIPEYLNFMRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLEL
FTELSEDKENYKMFYEHFSKNIKLGIHEDSQNRNKLSELLRYHTSASGGEMVSLKDYCTR
MKENQKHIYYITGETKEQVAHSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVS
VTKEGLELPEDEEEKKRQEEKKSKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTST
YGWTANMERIMKAQALRDNSTMGYMAAKKQLEINPDHSIIETLRQKADADKNDKSVKDLV
ILLFETALLSSGFSLEDPQTHSNRIYRMIRLGLGIDEDDDATEDLSAPATEEMPPLEGDG
DSSRMEEVD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgaagtgcagacagcaacccaggaacaacagatggaggaggatgtggagact
tttgcattccaggctgagattgctcagttgatgtctttgatcataaacacattctattcc
aataaagagattttcttgagggaactgatctctaactcatctgatgctctggacaagatc
agatatgagagtctgactgacccaagcaaacttgattctggaaaagaactgaaaattgaa
ctgatccctaacaagcaggaccgatccctcactattattgatactggcattgggatgacc
aaagctgatctcatcaacaacttggggaccattgccaagtctggtacaaaggcctttatg
gaggctttgcaggctggtgccgatatctccatgattggccagtttggtgttggtttctat
tctgcctacctagttgcagagaaagtcacagtgatcaccaaacacattgatgatgagcag
tatgcatgggagtcttctgctggaggatctttcactgttagagtggataacagtgaacca
cttggccgtggcacaaaggttattctgcatctcaaggaggatcagtcagaatattttgag
gaaaaaaggatcaaggagattgtgaagaagcactcccagtttattggctaccctattaca
ctttttgttgagaaagaacgcgataaagaaatcagtgatgacgaggcagaggaagaaaag
gaggaaaagaaagatgaacctaaagatgaggagaaaccagagattgaggatgtaggatct
gatgatgaggaagataagaaggaaggagacaagaaaaagaagaagaaaattaaagagaag
tacattgaccaagaagaactgaacaaaactaaacccatctggactagaaatcctgatgat
atcactaatgaagagtacggagagttctacaaaagcctaacgaatgactgggaagaccat
ttggcagttaaacacttctctgttgaaggccaacttgaatttcgggctctgctctttgtg
ccaagaagggctccatttgacttgtttgagaacagaaagaagaaaaacaatattaaacta
tatgtacgcagggtcttcattatggacaactgtgatgagctcattcctgaatatctgaat
ttcatgaggggagtcgttgactctgaagatcttccactgaacatttcaagagaaatgcta
cagcaaagcaaaattctgaaagttattagaaagaatttggtcaagaaatgtttagagctt
tttacagaactgtctgaagacaaggaaaactacaagatgttttatgaacatttctcaaag
aatattaagcttggtatccacgaagactctcaaaaccgcaacaagctctcagaattgctg
cgataccacacatcagcttcggggggtgaaatggtatcacttaaagattattgcacgagg
atgaaggaaaaccagaaacatatctattacattacaggtgaaacaaaagaacaggtggct
cactctgcatttgtggaaagacttcgaaagcatgggctggaagtaatttacatgatcgag
ccaattgatgagtactgtgtccaacaactgaaagaatttgaagggaaaaccttggtgtct
gttactaaggaaggattagaacttccagaggacgaggaagagaaaaagagacaggaggag
aaaaagtccaagtttgagaacttatgcaagataatgaaggacattttggaaaaaaaagta
gagaaggttgtagtgtccaacagacttgtgacttcaccttgctgtattgtaacaagcaca
tatggctggacagcgaacatggagagaataatgaaggcccaggcactgagggacaactct
actatgggctatatggctgcaaagaaacaactggaaattaaccctgatcattccataatt
gaaacactaagacaaaaggctgatgctgataaaaatgacaagtctgtaaaggatctggtc
attcttctctttgaaactgcactactttcatcaggcttcagtctagaagaccctcagaca
cattcaaaccgcatctacagaatgatcagacttggtcttggaattgatgaagatgatgat
gctactgaagacttgtcagcaccagcaactgaagagatgcctccgctcgaaggagatgga
gactcttctcgaatggaagaggttgattaa

DBGET integrated database retrieval system