KEGG   Xenopus laevis (African clawed frog): 444024Help
Entry
444024            CDS       T01010                                 

Gene name
hsp90aa1.1, hsp86, hsp89, hsp90, hsp90a, hspc1, hspca, hspn, lap2
Definition
heat shock protein 90kDa alpha (cytosolic), class A member 1, gene 1
Orthology
K04079  
molecular chaperone HtpG
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
NOD-like receptor signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    444024 (hsp90aa1.1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    444024 (hsp90aa1.1)
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    444024 (hsp90aa1.1)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     444024 (hsp90aa1.1)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    444024 (hsp90aa1.1)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   444024 (hsp90aa1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 729 aa AA seqDB search
MPDEVQTATQEQQMEEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKI
RYESLTDPSKLDSGKELKIELIPNKQDRSLTIIDTGIGMTKADLINNLGTIAKSGTKAFM
EALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHIDDEQYAWESSAGGSFTVRVDNSEP
LGRGTKVILHLKEDQSEYFEEKRIKEIVKKHSQFIGYPITLFVEKERDKEISDDEAEEEK
EEKKDEPKDEEKPEIEDVGSDDEEDKKEGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDD
ITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKL
YVRRVFIMDNCDELIPEYLNFMRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLEL
FTELSEDKENYKMFYEHFSKNIKLGIHEDSQNRNKLSELLRYHTSASGGEMVSLKDYCTR
MKENQKHIYYITGETKEQVAHSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVS
VTKEGLELPEDEEEKKRQEEKKSKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTST
YGWTANMERIMKAQALRDNSTMGYMAAKKQLEINPDHSIIETLRQKADADKNDKSVKDLV
ILLFETALLSSGFSLEDPQTHSNRIYRMIRLGLGIDEDDDATEDLSAPATEEMPPLEGDG
DSSRMEEVD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgaagtgcagacagcaacccaggaacaacagatggaggaggatgtggagact
tttgcattccaggctgagattgctcagttgatgtctttgatcataaacacattctattcc
aataaagagattttcttgagggaactgatctctaactcatctgatgctctggacaagatc
agatatgagagtctgactgacccaagcaaacttgattctggaaaagaactgaaaattgaa
ctgatccctaacaagcaggaccgatccctcactattattgatactggcattgggatgacc
aaagctgatctcatcaacaacttggggaccattgccaagtctggtacaaaggcctttatg
gaggctttgcaggctggtgccgatatctccatgattggccagtttggtgttggtttctat
tctgcctacctagttgcagagaaagtcacagtgatcaccaaacacattgatgatgagcag
tatgcatgggagtcttctgctggaggatctttcactgttagagtggataacagtgaacca
cttggccgtggcacaaaggttattctgcatctcaaggaggatcagtcagaatattttgag
gaaaaaaggatcaaggagattgtgaagaagcactcccagtttattggctaccctattaca
ctttttgttgagaaagaacgcgataaagaaatcagtgatgacgaggcagaggaagaaaag
gaggaaaagaaagatgaacctaaagatgaggagaaaccagagattgaggatgtaggatct
gatgatgaggaagataagaaggaaggagacaagaaaaagaagaagaaaattaaagagaag
tacattgaccaagaagaactgaacaaaactaaacccatctggactagaaatcctgatgat
atcactaatgaagagtacggagagttctacaaaagcctaacgaatgactgggaagaccat
ttggcagttaaacacttctctgttgaaggccaacttgaatttcgggctctgctctttgtg
ccaagaagggctccatttgacttgtttgagaacagaaagaagaaaaacaatattaaacta
tatgtacgcagggtcttcattatggacaactgtgatgagctcattcctgaatatctgaat
ttcatgaggggagtcgttgactctgaagatcttccactgaacatttcaagagaaatgcta
cagcaaagcaaaattctgaaagttattagaaagaatttggtcaagaaatgtttagagctt
tttacagaactgtctgaagacaaggaaaactacaagatgttttatgaacatttctcaaag
aatattaagcttggtatccacgaagactctcaaaaccgcaacaagctctcagaattgctg
cgataccacacatcagcttcggggggtgaaatggtatcacttaaagattattgcacgagg
atgaaggaaaaccagaaacatatctattacattacaggtgaaacaaaagaacaggtggct
cactctgcatttgtggaaagacttcgaaagcatgggctggaagtaatttacatgatcgag
ccaattgatgagtactgtgtccaacaactgaaagaatttgaagggaaaaccttggtgtct
gttactaaggaaggattagaacttccagaggacgaggaagagaaaaagagacaggaggag
aaaaagtccaagtttgagaacttatgcaagataatgaaggacattttggaaaaaaaagta
gagaaggttgtagtgtccaacagacttgtgacttcaccttgctgtattgtaacaagcaca
tatggctggacagcgaacatggagagaataatgaaggcccaggcactgagggacaactct
actatgggctatatggctgcaaagaaacaactggaaattaaccctgatcattccataatt
gaaacactaagacaaaaggctgatgctgataaaaatgacaagtctgtaaaggatctggtc
attcttctctttgaaactgcactactttcatcaggcttcagtctagaagaccctcagaca
cattcaaaccgcatctacagaatgatcagacttggtcttggaattgatgaagatgatgat
gctactgaagacttgtcagcaccagcaactgaagagatgcctccgctcgaaggagatgga
gactcttctcgaatggaagaggttgattaa

DBGET integrated database retrieval system