KEGG   Xenopus laevis (African clawed frog): 444025Help
Entry
444025            CDS       T01010                                 

Gene name
prkg2
Definition
protein kinase, cGMP-dependent, type II (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    444025 (prkg2)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     444025 (prkg2)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   444025 (prkg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 783 aa AA seqDB search
MGNGSMKSKPPKQPDGQLVNFSINSCNKLRNADTVKNKVWELERELKKKDEKLKNKEQIF
QELQEQINKQNKVIEEMAEELRNKCVQLNKLQDVVKIQGSNFSSLDVQTCPTKILHALPP
KSLQGSPLKTISGLFSNSSKRKGAKEGVSAEPTSRYDGGDHQRFSLEKACVRKNTSEKIL
ISDALNKNQFTKRMDNHQIQDMVECMYERIYLQGEFIIRQGEPGSQIFVLADGKAEVFQD
SKLLTSIPVWTTFGELAILYNCTRTASVKAITNVRTWALDREVFQNIMRKTAQSKHEEYL
RFLKSVSLLKKLPDHKLMKIADCLELEYYETGDYIIREGEEGSTFFIIAKGKVKVTQSAE
GYEEPQYIKLLEKGDYFGEKALISDDVRSANILAYGERVECLVMDRETFNKTVGTYEELM
KCLEGYVANLTLDDERRHAKNSVNEQHLKAESMELNQMKKVFARFPSASPFENLEIVTTL
GVGGFGRVELVKVKYENLVFAMKCIKKRHIVDNMQQEHIHSEKNILKEACSPFIVKLYCT
FKDNKYVYMLLEACLGGELWSILRDRGSFDETTAKFCTGCVTEALEYLHQIGVLYRDLKP
ENLLLDSEGYVKLVDFGFAKKVFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWSLGIL
LYELLTGNPPFTGPDQMIIYNLILQGIEKIEFCKNITKRPEDLICRLCRQNPAERLGYMK
NGIADIKKHRWFNGFNWEGLNTRSLPSPLKPKLKGPTDHSHFDIYPPDEEIPPDELSGWD
QDF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggatccatgaaatctaaaccaccaaagcagccagatggacagctggtgaac
ttctccatcaactcctgcaacaagctccgtaatgcagacactgtaaagaacaaagtgtgg
gaactagagagagaacttaagaaaaaagatgaaaagctgaagaacaaagaacaaatattc
caagagctgcaggaacaaataaataagcagaataaagtgattgaagagatggcagaagaa
cttcgaaacaaatgtgtccaacttaacaaattgcaagatgttgtaaaaattcagggtagt
aacttctcatccctagatgtgcaaacctgtccaacaaaaatccttcatgctttaccacct
aaatcattgcagggttccccacttaagaccatttctggtctgtttagcaacagcagcaag
agaaaaggggcaaaggaaggagtttctgctgaacctaccagcagatatgatggaggtgat
catcaaagattctcattagaaaaagcatgtgttaggaaaaatacaagtgagaagattctt
atatcagatgctctgaacaagaaccagtttacgaagagaatggataaccaccaaattcaa
gacatggtagaatgcatgtatgaaagaatatatcttcaaggtgaatttattatcagacaa
ggagaaccaggaagccagatctttgtattagcagatggaaaagcagaagtttttcaggac
agcaaacttctgacatccatcccagtgtggacaacgtttggggaacttgcaatattgtac
aactgcacaagaacagcctctgttaaagcaatcaccaatgtcagaacatgggctctagac
cgtgaagtgtttcagaatataatgagaaagacagcccaaagtaaacatgaagaataccta
cgttttcttaagagtgtgtccttgttgaagaaactgcctgatcataagctaatgaagatc
gcagattgcttggaactggaatactatgaaactggtgattacattattcgtgaaggagaa
gaagggagcacattcttcattattgctaaaggaaaggtgaaagtgactcagagtgcagag
ggttatgaagaacctcagtatataaaacttttggaaaaaggagattactttggtgaaaaa
gctcttatcagtgatgatgtcagatccgcaaatattttagcatatggagaaagagtggag
tgtcttgtcatggaccgagagacatttaataagacagttggaacatacgaagaacttatg
aaatgtcttgagggatatgtagcaaatctgacccttgatgatgaaagaaggcatgccaag
aactcagtgaatgaacaacatctaaaagctgagtcaatggaattgaatcagatgaaaaaa
gtttttgcaagatttccgtctgcatccccttttgagaatctagaaattgtcacaacactg
ggtgtcggtgggttcgggagagtggagcttgtcaaggtaaaatatgagaatctggtgttt
gcaatgaaatgtattaagaagaggcacattgtggataacatgcaacaagaacatatacat
tctgaaaaaaacattttaaaagaagcttgctctccctttattgtaaaactatactgcact
ttcaaggataataagtatgtgtatatgcttcttgaagcatgccttggaggggagctttgg
agcattctaagagatagaggcagttttgatgaaactactgctaaattctgcactggatgc
gtcacagaggctttagagtatttgcatcaaataggggttctatatcgggatttgaagcca
gagaacttacttctggattcagaaggttatgttaaactggttgattttggatttgccaag
aaagttttccctgggcaaaaaacatggacattttgtggcacaccagaatatgttgctccg
gaagttatattaaacaaaggacatagcttcagtgtggatttctggtcattaggaatttta
ttgtatgagctcctaacaggaaaccctccttttactggacctgaccagatgataatctac
aatttgattctccaaggcattgagaaaattgaattctgcaaaaatataacaaaacgccct
gaagatttgatttgtcgactctgtaggcagaatccagcagaacgacttggatatatgaag
aatggcatagccgatattaaaaaacacaggtggtttaatggctttaactgggaaggactg
aatactaggagtctgccttctcctttaaaacctaagctaaaaggccccacagatcacagt
cattttgacatctacccaccagatgaagaaatccctccagatgagctgtcaggctgggat
caagacttctga

DBGET integrated database retrieval system