KEGG   Xenopus laevis (African clawed frog): 444044Help
Entry
444044            CDS       T01010                                 

Gene name
hadha
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    444044 (hadha)
   01212 Fatty acid metabolism
    444044 (hadha)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    444044 (hadha)
   00650 Butanoate metabolism
    444044 (hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    444044 (hadha)
   00071 Fatty acid degradation
    444044 (hadha)
   01040 Biosynthesis of unsaturated fatty acids
    444044 (hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    444044 (hadha)
   00310 Lysine degradation
    444044 (hadha)
   00380 Tryptophan metabolism
    444044 (hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    444044 (hadha)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     444044 (hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     444044 (hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 760 aa AA seqDB search
MAAARLVGVLARLGGANRTGYSCRHLSMASALLTRTHVNYEIKDDVAVVRFNTPNSKVNT
LSKQLQTEFSDVMNEIWANDAVQSAVLISSKPGCFIAGADINMIESCKSNQEVTQLSQEG
QKMFAKLEKSPKPIVAAINGSCLGGGLEVAIACQYRVATKDKKTVLGTPEVLLGLLPGAG
GTQRLPRMVGLPTAFDMMLTGRNIRADRAKRMGLVDQLVDPLGPGLKSPEERTIEYLEEV
AMDYARGIARKKISLKKEKGLIQKVTDYVMSVPFVRQQIYNTVEKKVKKQTKGLYPAPLK
IIEVVKTGLDQGQEAGYLAEAQKFGELGMTSESKALIGLYHGQVLCKKNKFGTPERPVQK
LAILGAGLMGAGIAQVSVDKGLKTILKDTTIEGLGRGQQQVYKGLNDKVKKKSVTSFERD
SIVTNLTGQLDYKGFETADMVIEAVFEDISIKHKVLQEVESVVPPHCIFASNTSALPISQ
IAAASKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLKQGKVIIVVKDGP
GFYTTRCLGPMMAEVVRVLQEGVDPKKLDALSTGFGFPVGASTLADEVGIDVAAHVAEDL
GKAFGERFGGGNIELLKAMVAKGFLGRKSGKGFYIYQQGVKSRPINSGTEEILEKFKLQA
KPEVSSDEDIQMRLVSRFVNEAVMCLQEGILANPVEGDIGAVFGLGFPPCLGGPFRYADA
FGAKHIVEKMRKYESVYGSQFTPCQLLIDHANDSSKKFHH
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgcgactcgttggggttctggccaggctcggaggcgctaacaggacaggt
tattcttgcagacatctctccatggcatcagcactactgacaagaacccacgtaaactat
gagatcaaagatgacgttgctgttgttcgatttaacacccccaattccaaggtgaacaca
ctgtccaagcagctgcagacagaattcagcgatgttatgaatgaaatctgggccaacgat
gccgtccaaagtgccgtcctgatctcttccaaaccaggctgcttcatcgctggggctgat
atcaacatgattgagtcctgtaagtccaatcaggaagtcacacaattgtcccaggaaggg
cagaagatgtttgccaagctggagaagtcccccaaacccatagttgctgccatcaatggt
tcctgcctgggaggtggactagaggtggccattgcctgccagtacagagtggcaacaaag
gacaagaagactgttctggggaccccagaggttttacttgggttgttgccgggggcagga
ggaacacagaggctgcccaggatggttggtcttcccactgcttttgacatgatgctgact
ggaagaaacatccgagctgacagagccaagaggatgggcttggtggatcagcttgttgat
ccgctcggaccaggcctgaaaagtccagaggagagaactatcgagtacctggaagaagta
gccatggactatgccagaggaattgccaggaagaagatctccttgaagaaagagaagggt
ctgatacagaaggtcacagactatgttatgtccgtgccatttgtccgccaacaaatctac
aacaccgtggagaaaaaagtgaaaaaacagacaaaggggctttaccctgcccccctcaag
attattgaggtggtaaagactgggctggatcaggggcaggaggccggctatcttgctgag
gcacagaaatttggtgagcttgggatgacctcagagtccaaagcactaattgggctgtac
catggacaggttctttgtaagaagaataagtttggcaccccggaaagaccagtgcagaaa
ttggctatacttggggctggtcttatgggagctggcattgctcaggtgtccgtggataaa
ggtttaaagaccattctaaaggacacaaccattgaaggcttaggaagaggccagcaacaa
gtctacaaaggacttaatgacaaggtgaagaagaagagtgtgacttcctttgagcgagac
agcattgtcaccaatctgacgggacaactggattataagggatttgagacggccgatatg
gtgatcgaggccgtgtttgaggatataagcattaaacataaagtattgcaggaggtggaa
tctgtcgtccccccacactgtatatttgccagcaacacatctgccctccccatctctcag
atagcagcggccagcaaaaggccagagaaggtgataggaatgcactatttctcccctgtg
gataagatgcaactgttggaaataatcactacagacaaaacgtctaaggacaccactgct
tctgctgtagccgtcggcctcaagcagggcaaggtcatcattgtggtaaaggatggacca
ggattctacactacccgctgcctgggccccatgatggctgaagtcgtccgtgtcctgcag
gaaggggtagatcccaagaaactggacgccctctctaccggctttggtttcccagtaggg
gcttctactctagctgatgaggtgggcattgatgtggcggctcacgtggctgaggatctg
ggcaaagcttttggagagcggtttgggggcggaaacattgagctattgaaagccatggtg
gccaaaggattcttggggcgtaaatctgggaaaggcttttatatctatcagcagggagtg
aagagccgacccattaactctggcactgaggaaatactggagaagttcaagctacaggcc
aagcctgaagtttcctcagatgaagacatccagatgcgcctggtcagtcgctttgtgaat
gaggcagtgatgtgtctgcaggagggaatcctcgctaacccagtagaaggagatattggg
gctgtgtttggccttggtttccccccttgtctgggaggcccattcagatatgctgatgcg
tttggagcgaagcacatagtagagaagatgaggaagtatgagagtgtatatggcagtcag
tttactccgtgccagttgctgattgatcatgccaacgactccagcaagaagttccaccac
tga

DBGET integrated database retrieval system