KEGG   Xenopus laevis (African clawed frog): 444044Help
Entry
444044            CDS       T01010                                 

Gene name
hadha.S, hadha
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit S homeolog
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00062  Fatty acid elongation
xla00071  Fatty acid degradation
xla00280  Valine, leucine and isoleucine degradation
xla00310  Lysine degradation
xla00380  Tryptophan metabolism
xla00410  beta-Alanine metabolism
xla00640  Propanoate metabolism
xla00650  Butanoate metabolism
xla01040  Biosynthesis of unsaturated fatty acids
xla01100  Metabolic pathways
xla01200  Carbon metabolism
xla01212  Fatty acid metabolism
Module
xla_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
xla_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
xla_M00085  Fatty acid biosynthesis, elongation, mitochondria
xla_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    444044 (hadha.S)
   00650 Butanoate metabolism
    444044 (hadha.S)
  Lipid metabolism
   00062 Fatty acid elongation
    444044 (hadha.S)
   00071 Fatty acid degradation
    444044 (hadha.S)
   01040 Biosynthesis of unsaturated fatty acids
    444044 (hadha.S)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    444044 (hadha.S)
   00310 Lysine degradation
    444044 (hadha.S)
   00380 Tryptophan metabolism
    444044 (hadha.S)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    444044 (hadha.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     444044 (hadha.S)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     444044 (hadha.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Bse634I
Motif
Other DBs
NCBI-GeneID: 444044
NCBI-ProteinID: NP_001085618
Xenbase: XB-GENE-959224
UniProt: Q6GPS9
Position
5S
AA seq 760 aa AA seqDB search
MAAARLVGVLARLGGANRTGYSCRHLSMASALLTRTHVNYEIKDDVAVVRFNTPNSKVNT
LSKQLQTEFSDVMNEIWANDAVQSAVLISSKPGCFIAGADINMIESCKSNQEVTQLSQEG
QKMFAKLEKSPKPIVAAINGSCLGGGLEVAIACQYRVATKDKKTVLGTPEVLLGLLPGAG
GTQRLPRMVGLPTAFDMMLTGRNIRADRAKRMGLVDQLVDPLGPGLKSPEERTIEYLEEV
AMDYARGIARKKISLKKEKGLIQKVTDYVMSVPFVRQQIYNTVEKKVKKQTKGLYPAPLK
IIEVVKTGLDQGQEAGYLAEAQKFGELGMTSESKALIGLYHGQVLCKKNKFGTPERPVQK
LAILGAGLMGAGIAQVSVDKGLKTILKDTTIEGLGRGQQQVYKGLNDKVKKKSVTSFERD
SIVTNLTGQLDYKGFETADMVIEAVFEDISIKHKVLQEVESVVPPHCIFASNTSALPISQ
IAAASKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLKQGKVIIVVKDGP
GFYTTRCLGPMMAEVVRVLQEGVDPKKLDALSTGFGFPVGASTLADEVGIDVAAHVAEDL
GKAFGERFGGGNIELLKAMVAKGFLGRKSGKGFYIYQQGVKSRPINSGTEEILEKFKLQA
KPEVSSDEDIQMRLVSRFVNEAVMCLQEGILANPVEGDIGAVFGLGFPPCLGGPFRYADA
FGAKHIVEKMRKYESVYGSQFTPCQLLIDHANDSSKKFHH
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgcgactcgttggggttctggccaggctcggaggcgctaacaggacaggt
tattcttgcagacatctctccatggcatcagcactactgacaagaacccacgtaaactat
gagatcaaagatgacgttgctgttgttcgatttaacacccccaattccaaggtgaacaca
ctgtccaagcagctgcagacagaattcagcgatgttatgaatgaaatctgggccaacgat
gccgtccaaagtgccgtcctgatctcttccaaaccaggctgcttcatcgctggggctgat
atcaacatgattgagtcctgtaagtccaatcaggaagtcacacaattgtcccaggaaggg
cagaagatgtttgccaagctggagaagtcccccaaacccatagttgctgccatcaatggt
tcctgcctgggaggtggactagaggtggccattgcctgccagtacagagtggcaacaaag
gacaagaagactgttctggggaccccagaggttttacttgggttgttgccgggggcagga
ggaacacagaggctgcccaggatggttggtcttcccactgcttttgacatgatgctgact
ggaagaaacatccgagctgacagagccaagaggatgggcttggtggatcagcttgttgat
ccgctcggaccaggcctgaaaagtccagaggagagaactatcgagtacctggaagaagta
gccatggactatgccagaggaattgccaggaagaagatctccttgaagaaagagaagggt
ctgatacagaaggtcacagactatgttatgtccgtgccatttgtccgccaacaaatctac
aacaccgtggagaaaaaagtgaaaaaacagacaaaggggctttaccctgcccccctcaag
attattgaggtggtaaagactgggctggatcaggggcaggaggccggctatcttgctgag
gcacagaaatttggtgagcttgggatgacctcagagtccaaagcactaattgggctgtac
catggacaggttctttgtaagaagaataagtttggcaccccggaaagaccagtgcagaaa
ttggctatacttggggctggtcttatgggagctggcattgctcaggtgtccgtggataaa
ggtttaaagaccattctaaaggacacaaccattgaaggcttaggaagaggccagcaacaa
gtctacaaaggacttaatgacaaggtgaagaagaagagtgtgacttcctttgagcgagac
agcattgtcaccaatctgacgggacaactggattataagggatttgagacggccgatatg
gtgatcgaggccgtgtttgaggatataagcattaaacataaagtattgcaggaggtggaa
tctgtcgtccccccacactgtatatttgccagcaacacatctgccctccccatctctcag
atagcagcggccagcaaaaggccagagaaggtgataggaatgcactatttctcccctgtg
gataagatgcaactgttggaaataatcactacagacaaaacgtctaaggacaccactgct
tctgctgtagccgtcggcctcaagcagggcaaggtcatcattgtggtaaaggatggacca
ggattctacactacccgctgcctgggccccatgatggctgaagtcgtccgtgtcctgcag
gaaggggtagatcccaagaaactggacgccctctctaccggctttggtttcccagtaggg
gcttctactctagctgatgaggtgggcattgatgtggcggctcacgtggctgaggatctg
ggcaaagcttttggagagcggtttgggggcggaaacattgagctattgaaagccatggtg
gccaaaggattcttggggcgtaaatctgggaaaggcttttatatctatcagcagggagtg
aagagccgacccattaactctggcactgaggaaatactggagaagttcaagctacaggcc
aagcctgaagtttcctcagatgaagacatccagatgcgcctggtcagtcgctttgtgaat
gaggcagtgatgtgtctgcaggagggaatcctcgctaacccagtagaaggagatattggg
gctgtgtttggccttggtttccccccttgtctgggaggcccattcagatatgctgatgcg
tttggagcgaagcacatagtagagaagatgaggaagtatgagagtgtatatggcagtcag
tttactccgtgccagttgctgattgatcatgccaacgactccagcaagaagttccaccac
tga

DBGET integrated database retrieval system