KEGG   Xenopus laevis (African clawed frog): 444184Help
Entry
444184            CDS       T01010                                 

Gene name
rac2.L, rac2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) L homeolog
  KO
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    444184 (rac2.L)
   04310 Wnt signaling pathway
    444184 (rac2.L)
   04370 VEGF signaling pathway
    444184 (rac2.L)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    444184 (rac2.L)
   04520 Adherens junction
    444184 (rac2.L)
  Cell motility
   04810 Regulation of actin cytoskeleton
    444184 (rac2.L)
GTP-binding proteins [BR:xla04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    444184 (rac2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
4L
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DDKETIEKLKEKKLSPISYPQGLALAKEIESVKYLECSALTQRGLKTVFDEAIRAVLCPP
PSRPKKGKCVVL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccattaagtgtgtagtggtgggcgatggagctgtgggtaaaacatgtcttctc
atcagttacacaaccaatgctttccctggggaatacatcccgactgtattcgacaattat
tcagcgaatgtgatggtggacagtaaaccagtaaacttgggcttgtgggatacagctggc
caggaggactatgatcgactgaggcctctttcctatcctcaaacagatgtgtttctcatt
tgcttttctttggtgagtccggcatcttatgagaacgttcgtgccaagtggtacccagaa
gtgagacaccactgtcccagcacaccaataattcttgttggaaccaagctggatctgcgg
gatgacaaagaaaccattgagaaacttaaggagaagaaattgtctccaatctcttaccca
cagggtttggctctggcaaaagagattgagtcagtcaaatacttggagtgctcagccttg
acacaacggggcctaaagacggtatttgatgaggctatccgagctgtgttatgtccccca
ccttcgaggcctaaaaaaggcaaatgtgtggtgctttaa

DBGET integrated database retrieval system