KEGG   Xenopus laevis (African clawed frog): 444213Help
Entry
444213            CDS       T01010                                 

Gene name
stambp-b, amsh, stambpb
Definition
STAM binding protein (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    444213 (stambp-b)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     444213 (stambp-b)
Peptidases [BR:xla01002]
 Metallo Peptidases
  Family M67
   444213 (stambp-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
AA seq 416 aa AA seqDB search
MPEHSDASLPPEERIRALVLKGTSVEVNDDIPPKRYYRSGVEMIRMANVYAGEGSTENAF
ILYNKYITLFIEKLPRHRDYKTANAPEKKETLKKLKEVAFPKAEELKKELHKRYKKEYEE
YSEKKRKEEEERARRQALQQQLDAEKQRVALMKQQQEQQEQFQAFEEMIRRKEMEAERLR
ILHQFSKDDSEPESLGGPLISGVNEPPVTPLLPSYGTVQPQTPAVDRSLKPSSYGNNSSG
ATSDGLRHVKIPRDVCFKFLHLSENNTQRGVETCGILCGKLLQNEFTITHVIVPKQSGGP
DYCNTESEEDLFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCS
PKFQETGFFKLTDYGMKEIGECRQKGFHPHCKDPPLFSSSSHVSVTEQDVTVMDLR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacacagtgatgccagcctgccccctgaagagaggatccgagctctggtgctg
aaggggacatcggtagaggtgaatgacgacattcctcccaagcgctactacaggtctgga
gtggaaatgatccgaatggccaatgtgtacgccggggagggcagcacagaaaacgccttt
atcttgtacaacaaatatatcacgctcttcatagagaagcttcccagacatcgggattac
aaaacagccaatgcacctgagaagaaagagaccctaaagaaactgaaggaagttgcgttt
cccaaggcagaggagctgaagaaagaacttcataaaagatacaaaaaagaatatgaagaa
tactcggagaaaaagaggaaggaggaggaagagcgtgctcgccgccaagctctgcagcag
caacttgatgcagaaaagcaacgagtggctcttatgaagcagcaacaggaacagcaggaa
cagtttcaggcctttgaggaaatgatccgcagaaaggagatggaggctgagcgactcaga
atcttacatcagttttctaaagatgactctgaacccgagtcactcgggggccctctcata
tctggggtgaatgagccccctgtcactcctctgctcccttcatatggaactgtacagcca
caaacacctgctgtagacagatctttgaagccatcctcttatggcaataacagtagtggt
gctaccagtgacgggctacgccatgtaaagattccgcgagatgtgtgtttcaagttcctg
cacctgtcagagaataacacgcagagaggggtggagacctgtggcattctctgcgggaaa
ctgttgcagaacgaattcacaatcacacacgtcattgtacccaaacagtcagggggccct
gattattgcaacaccgagagcgaagaggacttgttcctgatacaggaccaacaaggacta
atcacacttggctggatacacacccaccccacccaaactgctttcctctccagcgtggac
cttcacactcactgctcttaccagatgatgcttccagaatccatcgccattgtctgctcg
cccaaattccaggaaacaggattctttaaactgacggattacggcatgaaggagattggt
gaatgtcggcagaaaggttttcatccccactgcaaagacccacctctgttctcttccagt
agccatgtttcagtgaccgagcaggatgtcactgtgatggatctacgataa

DBGET integrated database retrieval system