KEGG   Xenopus laevis (African clawed frog): 444287Help
Entry
444287            CDS       T01010                                 

Gene name
cltc.L, cltc
Definition
(RefSeq) clathrin, heavy chain (Hc) L homeolog
  KO
K04646  
clathrin heavy chain
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    444287 (cltc.L)
   04142 Lysosome
    444287 (cltc.L)
Membrane trafficking [BR:xla04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    444287 (cltc.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   444287 (cltc.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
2L
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGDQAQVVIIDMNDASN
PIRRPISADNAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVSFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKVFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISSKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPETIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPEWIFLLRNVMRINPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPTEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTLSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERISRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKSLILVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWASVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSFMEV
VEAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEFDNAIITMMN
HATDAWKEGQFKDIITKVANVELYYKAIHFYLEFKPLLLNDLLMVLSPRLDHTRAVNFFT
KVKQLPLVKPYLRSVQNHNNKSVNEALNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDKLYKDAMQYASESKDTELAEELLQWFLVE
EKKECFAACLFTCYDLLRPDVVLETAWRHNIMEFAMPYFIQVMREYLSKVDKLDASESIR
KEEEQATETQPIVYGQPQLMLTAGPSVPVPPQAAYGYGYTAPAYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcctcccgatccgcttccaggagcacctgcagctccaaaatctgggtatt
aatccagccaacattggttttagtacccttacaatggagtctgataaattcatctgcatt
cgggagaaggtaggagaccaagcccaagtggttatcattgacatgaatgatgccagcaac
ccaattcgcaggcctatttcagctgacaatgccataatgaatccagccagcaaggtcatc
gctctgaaagctggaaaaacactccaaatttttaacattgaaatgaaaagcaagatgaag
gcccacaccatgaccgatgatgtctcattctggaaatggatctccttgaacactgtcgct
ttagtgactgacaatgcagtctatcattggagtatggagggggaatctcagccagtaaag
gtgtttgaccgacattcaagcctggcagggtgccagatcattaattatcgaacagatgca
aagcaaaagtggctgcttctcactggaatatctgcccagcaaaaccgggttgtgggagcc
atgcagctttactctgtagacaggaaagtgtctcagcccattgaaggacatgctgccagc
tttgcacagttcaagatggaaggaaatgctgaagaatcaaccctcttctgctttgctgta
aggggtcaagctgggggtaagctccatattatagaagttggtacaccacctacaggcaac
cagccatttccaaagaaagctgttgatgtcttctttcctccagaagctcagaatgatttt
cctgtagccatgcagattagcagtaagcacgatgttgtttttctgattacaaaatatggc
tacattcacctttatgacctagaaactggcacctgcatttatatgaatcgtataagtggg
gaaaccatctttgttactgcccctcatgaagccacagctggaatcatcggagttaacaga
aaaggacaggttctttctgtgtgtgtggaagaggagaacataatcccatatatcacaaac
gttctgcagaaccccgacctagctttgcgtatggctgtacgaaacaaccttgctggagct
gaggagctttttgctcgaaaattcaatgctctctttgcacaaggaaattattcagaagca
gcaaaggtggctgcaaatgccccaaagggaatactgcgtacaccggaaacgatccgccgt
ttccaaagtgttcctgcacaaccaggtcagacctccccattgctgcaatactttggaatt
cttttagaccaaggccagctgaacaagtttgaatcattggagctttgcagacctgtgttg
caacaaggtcgcaaacaactgttggaaaaatggcttaaggaagacaagctggagtgttcg
gaagaattgggagatctcgtaaagtctgttgaccctacacttgccttgagtgtttatctg
agggctaatgttccaaataaagtaattcagtgctttgcagagactggacaggttcagaag
attgtgctgtatgcaaaaaaggtgggctatacccctgaatggattttcctgctgcgaaat
gttatgcgaatcaatccagaccaaggccaacagttcgctcaaatgttggtccaagatgag
gagcctcttgcggatatcacccagattgtggatgtctttatggaatacaaccttatccaa
caatgcactgctttcttattggatgctctaaaaaacaaccgtccaactgaaggtcctttg
caaacccgtctccttgaaatgaatctgatgcatgcacctcaggtggctgatgcgattttg
ggcaaccagatgtttacacattacgaccgtgctcacattgcacagctttgtgagaaagca
ggccttcttcagagagccttggaacacttcacagatctgtatgacataaaaagggcagtt
gtccacacacatcttttgaatcctgagtggctggtgaattattttggctccttgtctgtt
gaagattctctcgaatgcttgcgtgccatgctttctgcaaacattcggcaaaatttgcag
atttgtgtccaggtcgcttccaaataccatgagcagctttccactctgtcactcattgaa
ctttttgaatctttcaagagctttgaagggctgttttatttcttgggctctattgtcaac
tttagccaggatcccgatgtgcattttaaatatatccaggcagcttgcaaaaccggtcaa
attaaagaagttgaaagaataagcagagagagtaactgttatgatcctgagcgagtgaaa
aacttccttaaggaagccaagctcacagaccagctgccactgataattgtatgtgatcgt
tttgactttgttcacgaccttgtcctgtatctgtacaggaacaacctacagaaatacatt
gagatctatgttcaaaaggtaaatccaagtcggttgccagtagttattggaggcctgctt
gatgtggattgttcagaagatgtcattaagagtcttatccttgttgtgcggggacagttc
tctacagatgagcttgttgctgaagttgagaaaagaaacaggttgaaactgcttttgcca
tggctagaatctcgaattcatgagggttgtgaagagcctgccactcataatgctttggct
aaaatctacatagatagcaacaataatcctgaacgattcctacgagagaacccatactac
gatagccgcgttgttggaaagtattgtgaaaaaagggacccccatcttgcatgtgttgca
tatgaacgaggacagtgtgatctggaactaataaacgtttgcaatgaaaattctcttttc
aaaagcctttcccgttaccttgtacgtcgtaaggatccagaattgtgggccagtgtcttg
ctagaaagcaacccatataggagacctctaattgatcaggttgtgcaaacagctttgtct
gaaacgcaggatcctgaagaggtgtctgttactgtgaaagcctttatgacagcagacctt
cccaatgagctcattgaattgttggagaaaattgtattggacaactctgtctttagtgaa
cacagaaatctgcagaacctcttgattctgactgcaattaaagctgaccgcacaagggtc
atggaatatattaatcgtctggataattatgatgccccagatattgcaaacattgccata
agcaatgagttgtttgaggaagcatttgctattttcaggaaatttgatgtgaacacctca
gctgtgcaggtattgattgaacacatcgggaatttggaccgggcatatgaatttgctgag
cgatgtaacgaaccagctgtttggagtcagcttgccaaagcgcagttacagaaagggatg
gttaaagaagctattgattcctacataaaagcagatgatccttcttctttcatggaagtt
gttgaagctgctaatgccagtggaaattgggaggagttggttaaatacctgcaaatggct
cgtaaaaaggcacgagaatcctatgtggaaactgagcttatatttgctcttgctaaaaca
aatcgccttgcagaactggaggagttcattaatggaccaaataatgcacacattcagcag
gttggtgatcgctgctatgatgaaaaaatgtatgacgctgctaagctcctctataacaat
gtttcaaattttggacgtttggcatccacattggttcacttgggagagtatcaagcagct
gtggatggtgcccgtaaggcaaatagcacacgcacttggaaagaggtttgctttgcttgt
gttgatggaaaagagtttcgcctggcgcagatgtgtggccttcatattgtggttcatgct
gatgaattggaggagcttataaattattaccaggatagagggtattttgaagaactaatc
actatgctggaggcagctcttggactggaaagggcgcacatgggaatgttcactgaactt
gcaatcctttactccaaatttaaaccccagaaaatgagggagcacttggagcttttctgg
tcaagagtcaatattccaaaggtgctgagagcagcagaacaggcacacttgtgggcagaa
ttagtattcctgtatgataaatatgaagagtttgacaatgctatcatcacaatgatgaac
catgccacagatgcatggaaggaaggacaatttaaagatatcattacaaaggtcgcaaat
gttgaattgtattacaaagcaatccatttttatttggagttcaagccactgctactgaat
gatcttctgatggtgctctcaccaagacttgaccacacccgtgcagtaaactttttcacc
aaggtgaaacagcttcctctggtaaaaccatatctgcgttcagttcagaatcacaacaac
aaatctgtgaatgaggctttaaacaatctgttcattacagaagaagattaccaggcactt
cgaacctctatagatgcatatgacaactttgataacatttcccttgcgcaacgactcgag
aagcatgagctaattgaatttagaagaattgctgcatatctattcaagggcaataatcgt
tggaagcaaagtgtggagctttgtaaaaaagacaagctctacaaggatgctatgcagtat
gcctctgaatccaaagatacagaattggcggaggaacttctacagtggtttttggttgag
gagaaaaaggaatgctttgcagcctgtctctttacctgctatgacttgctgcgaccagat
gttgttttggaaacagcatggaggcacaacatcatggaatttgctatgccctacttcatt
caggtcatgagggagtacttatctaaggttgacaaattggatgcctcagaatccattaga
aaagaagaagagcaagcaacagagacacaacccattgtttatggccagccacagctgatg
ttgactgcaggacccagtgttccagttcctcctcaagctgcgtatggctatggctatact
gcacctgcatatgggcaacctcaacctggctttgggtattccatgtaa

DBGET integrated database retrieval system