KEGG   Xenopus laevis (African clawed frog): 444287Help
Entry
444287            CDS       T01010                                 

Gene name
cltc
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:xla04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:xla04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGDQAQVVIIDMNDASN
PIRRPISADNAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVSFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKVFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISSKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPETIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPEWIFLLRNVMRINPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPTEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTLSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERISRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKSLILVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWASVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSFMEV
VEAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEFDNAIITMMN
HATDAWKEGQFKDIITKVANVELYYKAIHFYLEFKPLLLNDLLMVLSPRLDHTRAVNFFT
KVKQLPLVKPYLRSVQNHNNKSVNEALNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDKLYKDAMQYASESKDTELAEELLQWFLVE
EKKECFAACLFTCYDLLRPDVVLETAWRHNIMEFAMPYFIQVMREYLSKVDKLDASESIR
KEEEQATETQPIVYGQPQLMLTAGPSVPVPPQAAYGYGYTAPAYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcctcccgatccgcttccaggagcacctgcagctccaaaatctgggtatt
aatccagccaacattggttttagtacccttacaatggagtctgataaattcatctgcatt
cgggagaaggtaggagaccaagcccaagtggttatcattgacatgaatgatgccagcaac
ccaattcgcaggcctatttcagctgacaatgccataatgaatccagccagcaaggtcatc
gctctgaaagctggaaaaacactccaaatttttaacattgaaatgaaaagcaagatgaag
gcccacaccatgaccgatgatgtctcattctggaaatggatctccttgaacactgtcgct
ttagtgactgacaatgcagtctatcattggagtatggagggggaatctcagccagtaaag
gtgtttgaccgacattcaagcctggcagggtgccagatcattaattatcgaacagatgca
aagcaaaagtggctgcttctcactggaatatctgcccagcaaaaccgggttgtgggagcc
atgcagctttactctgtagacaggaaagtgtctcagcccattgaaggacatgctgccagc
tttgcacagttcaagatggaaggaaatgctgaagaatcaaccctcttctgctttgctgta
aggggtcaagctgggggtaagctccatattatagaagttggtacaccacctacaggcaac
cagccatttccaaagaaagctgttgatgtcttctttcctccagaagctcagaatgatttt
cctgtagccatgcagattagcagtaagcacgatgttgtttttctgattacaaaatatggc
tacattcacctttatgacctagaaactggcacctgcatttatatgaatcgtataagtggg
gaaaccatctttgttactgcccctcatgaagccacagctggaatcatcggagttaacaga
aaaggacaggttctttctgtgtgtgtggaagaggagaacataatcccatatatcacaaac
gttctgcagaaccccgacctagctttgcgtatggctgtacgaaacaaccttgctggagct
gaggagctttttgctcgaaaattcaatgctctctttgcacaaggaaattattcagaagca
gcaaaggtggctgcaaatgccccaaagggaatactgcgtacaccggaaacgatccgccgt
ttccaaagtgttcctgcacaaccaggtcagacctccccattgctgcaatactttggaatt
cttttagaccaaggccagctgaacaagtttgaatcattggagctttgcagacctgtgttg
caacaaggtcgcaaacaactgttggaaaaatggcttaaggaagacaagctggagtgttcg
gaagaattgggagatctcgtaaagtctgttgaccctacacttgccttgagtgtttatctg
agggctaatgttccaaataaagtaattcagtgctttgcagagactggacaggttcagaag
attgtgctgtatgcaaaaaaggtgggctatacccctgaatggattttcctgctgcgaaat
gttatgcgaatcaatccagaccaaggccaacagttcgctcaaatgttggtccaagatgag
gagcctcttgcggatatcacccagattgtggatgtctttatggaatacaaccttatccaa
caatgcactgctttcttattggatgctctaaaaaacaaccgtccaactgaaggtcctttg
caaacccgtctccttgaaatgaatctgatgcatgcacctcaggtggctgatgcgattttg
ggcaaccagatgtttacacattacgaccgtgctcacattgcacagctttgtgagaaagca
ggccttcttcagagagccttggaacacttcacagatctgtatgacataaaaagggcagtt
gtccacacacatcttttgaatcctgagtggctggtgaattattttggctccttgtctgtt
gaagattctctcgaatgcttgcgtgccatgctttctgcaaacattcggcaaaatttgcag
atttgtgtccaggtcgcttccaaataccatgagcagctttccactctgtcactcattgaa
ctttttgaatctttcaagagctttgaagggctgttttatttcttgggctctattgtcaac
tttagccaggatcccgatgtgcattttaaatatatccaggcagcttgcaaaaccggtcaa
attaaagaagttgaaagaataagcagagagagtaactgttatgatcctgagcgagtgaaa
aacttccttaaggaagccaagctcacagaccagctgccactgataattgtatgtgatcgt
tttgactttgttcacgaccttgtcctgtatctgtacaggaacaacctacagaaatacatt
gagatctatgttcaaaaggtaaatccaagtcggttgccagtagttattggaggcctgctt
gatgtggattgttcagaagatgtcattaagagtcttatccttgttgtgcggggacagttc
tctacagatgagcttgttgctgaagttgagaaaagaaacaggttgaaactgcttttgcca
tggctagaatctcgaattcatgagggttgtgaagagcctgccactcataatgctttggct
aaaatctacatagatagcaacaataatcctgaacgattcctacgagagaacccatactac
gatagccgcgttgttggaaagtattgtgaaaaaagggacccccatcttgcatgtgttgca
tatgaacgaggacagtgtgatctggaactaataaacgtttgcaatgaaaattctcttttc
aaaagcctttcccgttaccttgtacgtcgtaaggatccagaattgtgggccagtgtcttg
ctagaaagcaacccatataggagacctctaattgatcaggttgtgcaaacagctttgtct
gaaacgcaggatcctgaagaggtgtctgttactgtgaaagcctttatgacagcagacctt
cccaatgagctcattgaattgttggagaaaattgtattggacaactctgtctttagtgaa
cacagaaatctgcagaacctcttgattctgactgcaattaaagctgaccgcacaagggtc
atggaatatattaatcgtctggataattatgatgccccagatattgcaaacattgccata
agcaatgagttgtttgaggaagcatttgctattttcaggaaatttgatgtgaacacctca
gctgtgcaggtattgattgaacacatcgggaatttggaccgggcatatgaatttgctgag
cgatgtaacgaaccagctgtttggagtcagcttgccaaagcgcagttacagaaagggatg
gttaaagaagctattgattcctacataaaagcagatgatccttcttctttcatggaagtt
gttgaagctgctaatgccagtggaaattgggaggagttggttaaatacctgcaaatggct
cgtaaaaaggcacgagaatcctatgtggaaactgagcttatatttgctcttgctaaaaca
aatcgccttgcagaactggaggagttcattaatggaccaaataatgcacacattcagcag
gttggtgatcgctgctatgatgaaaaaatgtatgacgctgctaagctcctctataacaat
gtttcaaattttggacgtttggcatccacattggttcacttgggagagtatcaagcagct
gtggatggtgcccgtaaggcaaatagcacacgcacttggaaagaggtttgctttgcttgt
gttgatggaaaagagtttcgcctggcgcagatgtgtggccttcatattgtggttcatgct
gatgaattggaggagcttataaattattaccaggatagagggtattttgaagaactaatc
actatgctggaggcagctcttggactggaaagggcgcacatgggaatgttcactgaactt
gcaatcctttactccaaatttaaaccccagaaaatgagggagcacttggagcttttctgg
tcaagagtcaatattccaaaggtgctgagagcagcagaacaggcacacttgtgggcagaa
ttagtattcctgtatgataaatatgaagagtttgacaatgctatcatcacaatgatgaac
catgccacagatgcatggaaggaaggacaatttaaagatatcattacaaaggtcgcaaat
gttgaattgtattacaaagcaatccatttttatttggagttcaagccactgctactgaat
gatcttctgatggtgctctcaccaagacttgaccacacccgtgcagtaaactttttcacc
aaggtgaaacagcttcctctggtaaaaccatatctgcgttcagttcagaatcacaacaac
aaatctgtgaatgaggctttaaacaatctgttcattacagaagaagattaccaggcactt
cgaacctctatagatgcatatgacaactttgataacatttcccttgcgcaacgactcgag
aagcatgagctaattgaatttagaagaattgctgcatatctattcaagggcaataatcgt
tggaagcaaagtgtggagctttgtaaaaaagacaagctctacaaggatgctatgcagtat
gcctctgaatccaaagatacagaattggcggaggaacttctacagtggtttttggttgag
gagaaaaaggaatgctttgcagcctgtctctttacctgctatgacttgctgcgaccagat
gttgttttggaaacagcatggaggcacaacatcatggaatttgctatgccctacttcatt
caggtcatgagggagtacttatctaaggttgacaaattggatgcctcagaatccattaga
aaagaagaagagcaagcaacagagacacaacccattgtttatggccagccacagctgatg
ttgactgcaggacccagtgttccagttcctcctcaagctgcgtatggctatggctatact
gcacctgcatatgggcaacctcaacctggctttgggtattccatgtaa

DBGET integrated database retrieval system