KEGG   Xenopus laevis (African clawed frog): 444326Help
Entry
444326            CDS       T01010                                 

Gene name
c1galt1
Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    444326 (c1galt1)
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     444326 (c1galt1)
Glycosyltransferases [BR:xla01003]
 Glycan extension
  Type 3 chain
   444326 (c1galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MSIICAKVAWLPLTLGTAMGFLITFYLARTLLERNSQPPLALRSWNNMELLPEVGMSHFH
LPEDNSVSEELSKKVRVLCWIMTGPTNLKTKAIHVKNSWTRHCNVALFMSSITDEDFPAI
GLGTGEGRDKLYWKTIRAFHYAHKYYLNETEWFFKADDDTYVIMDNLRWMLSNYTADQPI
YFGKRFKPYIKQGYMSGGAGYVLSREALIRFVEGFRTGVCKHTTSTEDVAIGNCMQLMGV
IAGDSRDTEKRETFHPFPPEHHLTMKFSESKSFWYWSYCVYPIVEGPQCCSDLAISFHYI
SPEDMYTLEYFIYHLRAHGYQYRYQPPLSDNADNLPVYIENETVKPNRTISDFLEPPMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattatatgtgccaaggtggcatggctgccattgactttgggaactgctatgggc
ttcctcattactttctacttggctcgaacacttttggagagaaattcacagcctccgtta
gctctccgttcatggaacaacatggaactacttccagaggttggaatgtcccattttcat
ctgccagaagataatagtgtgagtgaggaactctccaaaaaggtcagagtgctttgttgg
atcatgactggaccgacaaacctaaagaccaaagctattcatgtgaagaattcctggacc
cgtcactgcaatgtagcgctattcatgagctccatcaccgatgaagacttccccgccatt
ggtctgggaactggggaaggcagagacaaactttactggaaaacaattcgtgccttccat
tacgcccataagtactacctgaatgagacagaatggttcttcaaggcagatgatgataca
tatgtaataatggacaatttacgatggatgctttcgaactataccgctgaccagcctatt
tactttgggaagcgcttcaaaccatatatcaagcagggctacatgagtggaggagctgga
tatgttcttagcagggaagcccttatacgctttgtggaaggtttccgtactggtgtctgc
aagcacacaacctcaacagaagatgtggctattggcaactgcatgcagctaatgggggtc
atagctggggactctagggacactgagaaaagagaaaccttccaccctttcccccctgaa
caccacctcactatgaagtttagtgagtctaagtcattttggtattggagctactgtgtc
tatcctattgtggagggcccccagtgctgctcagatctggccatttcctttcattacatt
agtccagaagacatgtacactttggaatattttatataccatctccgggcacatggatac
cagtatcgttaccagccgccgttatcagacaatgcagacaacctccctgtttacatagaa
aatgaaactgtaaaacctaataggaccatatctgacttcttagaaccaccaatggagtca
taa

DBGET integrated database retrieval system