KEGG   Xenopus laevis (African clawed frog): 444339Help
Entry
444339            CDS       T01010                                 

Gene name
usp22_a, usp22-A
Definition
ubiquitin specific peptidase 22 (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     444339 (usp22_a)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   444339 (usp22_a)
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     444339 (usp22_a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 523 aa AA seqDB search
MSPAGCSHVNSFKVENWKQNLRVIYQCFVWSGTPETRKRKAKSCICHMCGAHLNRLHSCL
YCVFFGCFTKKHIHEHAKNKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQVAKEEQRKAWK
LQVFSPALVSPYQYTMTGVGEKYSTWEPTKRELELLQHNPKRRKITTNCTIGLRGLINLG
NTCFMNCIVQALTHTPLLRDFFLSDRHKCEMQSPNSCLVCEMSTLFQEFYSGHRSPHIPY
RLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFT
GGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDAGVVNGESHVSGTTTL
TDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKI
TTYVSFPLELDMTPFMASSKESRMNGQYQQPSDSLHNDNKYSLFAVVNHQGTLESGHYTS
FIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggccggctgctcccatgtgaacagctttaaggtggagaattggaagcaaaac
ctgcgagtaatttaccagtgctttgtgtggagtggtactcctgaaaccagaaagaggaag
gctaagtcgtgcatctgtcatatgtgtggagctcacttgaacagacttcactcttgtctc
tactgtgttttctttggctgctttacgaagaaacatattcacgaacacgcaaaaaataag
agacacaatctggctatagatctgttgtatgggggtatatactgctttatgtgtcaagat
tatatatatgacaaagatatggagcaagttgccaaagaagaacaacgaaaagcttggaaa
ttgcaagttttctcccctgcactggtttctccataccagtatacaatgactggagttgga
gaaaagtattcaacgtgggagccaacaaagcgggaactagagctgttacagcataacccc
aagagaagaaaaattaccacaaattgtactataggtttgcgaggtttaattaatcttggg
aacacatgttttatgaactgtattgtccaggcacttacccacactcccttgctacgagat
ttcttcctttcggacagacataaatgtgaaatgcaaagccccaactcttgccttgtttgt
gaaatgtctacgctctttcaggagttttactccggacaccgttctcctcacattccatat
aggttactccaccttgtatggacacacgcacgacatttagcagggtacgagcagcaagat
gcacacgagtttctcattgctgctttagatgttctgcacagacattgcaaaggtgatgat
aatgggaaaaaggccaacaatccaaaccactgtaactgtatcatagaccaaatcttcaca
ggaggcctacagtcagatgtaacttgtcaagtgtgccatggggtctctacgactatagat
ccattttgggacatcagcttagatctgccaggctcttcaactccattctggcctcttagc
ccaggaagtgatgctggtgttgtgaatggggagagtcatgtgtcaggaacaacaacgctc
acagactgcctccggaggtttacacgaccagagcatctaggaagtagtgccaaaattaaa
tgcagtggttgccatagctaccaggaatctactaaacagctgactatgaagaaattgcct
attgtggcttgttttcatctcaaacgatttgagcattcggctaaactgaggcggaagatt
acaacatatgtgtcattccctttggagctggacatgacgccatttatggcctccagtaaa
gaaagccgaatgaatggacagtatcagcaaccatctgatagtttacacaatgacaataag
tattccttgtttgcagtagttaatcaccagggaaccttggagagtgggcattacacaagc
ttcatcaggcaacacaaggaccagtggttcaaatgtgatgatgcgattattaccaaggct
agcattaaagatgttctagatagtgaagggtatttgcttttctatcacaagcagtttctg
gagtatgagtaa

DBGET integrated database retrieval system