KEGG   Xenopus laevis (African clawed frog): 444360Help
Entry
444360            CDS       T01010                                 

Gene name
ctrb2
Definition
chymotrypsinogen B2
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 263 aa AA seqDB search
MALLCLLSCIALIGSTYGCGVPGIKPIISGYARIVNGENAVSGSWPWQVSLQDRTGFHFC
GGSLVNNLWVVTAAHCGVTTSHRVILGEYDRSSSAEPIQTMSISRVFRHANYNTYSMIND
ITLLKLSSPASFNSRVAPVCVPTSSEVFNSAERCVTTGWGYVDANSKLSPNKLQQVTLPL
LSNTECQRYWGNKIHSTMICAGASGASSCMGDSGGPLVCQRNGVWALAGIVSWGSSTCSP
SSPGVYARVTTLRSWMDQIVASN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcactgctttgcctcttgtcctgtattgcccttattggaagtacttatggctgtggt
gtccctggcattaaacccattatttctggatacgccagaattgtgaatggtgagaatgca
gtctctgggtcctggccgtggcaagtgtctctacaggacagaactggattccatttctgt
ggtggttccctggtgaataacttatgggtcgtaactgctgctcattgtggcgtcacaacc
tcacaccgtgttattctgggtgaatatgatcgttcttcttcagctgagccaattcaaacc
atgtctatttccagggttttcagacatgcaaattacaacacctattctatgatcaatgac
attactttgttgaaactctccagtcctgcctctttcaacagccgtgtcgctcctgtctgt
gttcctacctccagtgaagtttttaattctgctgaaagatgtgtcacaactggatgggga
tatgtcgatgccaactcaaaattatctccaaacaagcttcagcaagttaccctgcctctt
ctctccaacactgaatgtcagaggtactggggtaataagatccatagtactatgatttgt
gctggagcatctggtgcctcctcttgcatgggggactctggtggaccacttgtgtgccaa
agaaatggagtttgggcgctggctggtattgtgtcctggggaagttctacttgttctcca
tcatcccctggagtatatgctcgtgtcacaactcttagatcctggatggatcagattgtt
gcttccaattaa

DBGET integrated database retrieval system