KEGG   Xenopus laevis (African clawed frog): 444422Help
Entry
444422            CDS       T01010                                 

Gene name
alad
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xla00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 330 aa AA seqDB search
MQADSILHSGYFHPVLRAWQSTATSLDANNLMYPIFITDNSDAVEDIPSLPGQARYGVNQ
LDVLLRPLVDNGLKCVLIFGVPSRVTKDDRGSAADADDTPAILAIRRIREKFPQLLVACD
VCLCPYTSHGHCGILREDGSIQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQ
ALISNDLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLALRAVDR
DVREGADMLMVKPGIPYLDLVRDVKDKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAV
LEAMTGFRRAGADIIITYYTPQLLNWIKER
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagactccatcctacacagcggctatttccaccctgtgctccgggcctggcag
agcactgctaccagtctagatgccaacaacctcatgtaccccatctttatcacggataac
tcggatgctgttgaggacattcccagcttgccaggccaagccaggtatggggtaaaccag
ttggatgtcttgctgcgccctctggtggacaatgggctgaagtgcgtgctgatcttcggg
gtcccaagcagagtcactaaggatgaccgtggctccgcagcagacgcagacgacacgccg
gccatattggccatacggaggattcgggaaaagttcccccagctgctcgttgcatgtgat
gtttgcctttgtccctatacatctcatgggcactgtgggattctacgagaagatggcagc
atacagaacgagagcagctgccagagattagcagaagtggcccttgcttatgcccgtgca
ggctgtcacatcgttgcaccttcagacatgatggatggacgaattggcgccataaagcag
gctctgatctccaatgacctgggaaacaaggtgtccgtcatgagttacagcgccaaattt
gcctcctgcttttatgggccgtttagggacgccgcgcagtctaaacccgcctttggtgat
cggaaatgttaccaacttccacctggtgccaggggcctcgccctccgggcagtggaccgg
gatgtgcgtgaaggggcagacatgctgatggtgaagccggggataccatatttggatctg
gtcagagacgtcaaggacaagcaccctgctctcccattggctgtgtaccatgtgtctgga
gaatatgccatgttgtggcacggggcgcaggctaatgcttttgaccttaaggtagccgta
ctggaagcgatgactggattccggagagccggagcggatatcatcatcacctactacacc
ccccagctcctcaactggataaaggaaagataa

DBGET integrated database retrieval system