KEGG   Xenopus laevis (African clawed frog): 444490Help
Entry
444490            CDS       T01010                                 

Gene name
aox1, aoh1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    444490 (aox1)
   00350 Tyrosine metabolism
    444490 (aox1)
   00380 Tryptophan metabolism
    444490 (aox1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    444490 (aox1)
   00760 Nicotinate and nicotinamide metabolism
    444490 (aox1)
   00830 Retinol metabolism
    444490 (aox1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    444490 (aox1)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     444490 (aox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1245 aa AA seqDB search
MLISYLRKTYIILLMPVWCPSALCMAWQSQQLKGLAAHPQDYIQYRNHPEPTLEQIYDTL
GGNLCRCTGYRPIVDGCKSFCKEENCCQLQENIPNLPGMEPQNSNISTQLFNKEKFSPLD
PSQELIFPPDLILMAKQHKPKTLIFHGERIKWITPHSLEELLALKVQYPDAPLLVGNTSI
GLQMKMEGIIYPVILSVSRIEDLNVVKYTNDGISVGAACSLSVLRDTLNKAVLEHPEEKT
KTFCALLQQLKTLAGRQIKNMASLGGHVIIKDSLSDLNPVLAAANSSLHVLSKAGAREIH
CNEAYFESIEHASLLPEEVLISVLIPFSQKWEVVSAFRQAQRKVNAAPIVVTGMRVLFQE
NTDIIKDLNIFFGGIQKSTLCAKKTRMGVIGRHWDDEMLSEACRLILDEITLPPTAQGGM
VEYRRTLTISFFLKFYLQVLQVLISWNIRDMEPSLSGAVSKENLSAKGSNIQRYQDVSAD
QSHQDTVGRPIMHQAAIKQVSGEAEYCDDMPAIDGELFMALVTSSRAHAKILSMDLTEAK
NMPGVCDVITAKDIPETNDFYYFNWPEQLMADDKVLCVGYIICAVVADTQEHAKQAAKKV
KVIYQDIEPTILTIEDAIRHKSFFETERKLHHGNIDKGFKTADHILEGEIYIGGQEHFYM
ETQSIRVVPSKEDKEMHIYAASQDPSYMQGLVASTLNIPSNRVNCHVKRIGGAFGGKITK
TAFIAAITAVAARKTKQAIRCVLERDEDMLITAGRHPYLGKYKVGFTNDGRITAADVTYY
SNAGCSVTESVFIMEASVLQINNAYNIPNLRCQGIVCKTNLPSNVSFRGFGFPQCALVTE
VWIEEVAVKCNLPTHKVKEINMYRGNIVAPYKQEFDTTNLLKCWEECLESSEYHARRQSV
AQFNQQNQWAKRGISIIPMKFPVSFTKSIENQAAALVHIFIDGSVLVSHGGTEMGQGIHT
KIMQIASRELGIPITYIHISETSTSSVPNTIASAATVGTDVNGMAVKDACEKLRKRLKPI
VSRNPSGTWESWIKEAFLQRISLSATGYFRGYETYMDWEKGEGHPYQYCVFGTACSEVEV
DCLSGDYTNIRTDIVMDIGSSINPAVDLGQIEGAFVQGIGLFTMEELKYSPEGVLYTRGP
GQYKIPSVCDIPKQFHVSVLPSSHNPHAIYSSKGVGEPGIFLGSSVYFAIKDAMLSARRD
RGLSDIFTLNSPATPEKIRMGCGDSFTDMIPKDNPELFIPWAINV
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgttgatctcctaccttcgcaagacatacattattctgttaatgcctgtctggtgccca
tctgctctctgcatggcatggcagtcacaacagttgaagggattggcagcacatccacaa
gattacatccagtacaggaaccatccagaacctactttggagcaaatatatgatactttg
ggaggtaatttatgccgctgcactggatacagaccaatagtggatggatgtaagagcttc
tgtaaggaggaaaactgctgccagctacaagaaaacataccaaacctgccaggaatggag
cctcagaatagtaatatctctacacagctgtttaacaaagaaaagttttcgccattggat
ccatcccaggaactgatatttccaccagacttaattttgatggcaaagcaacacaaacca
aaaactttgatttttcatggagagagaatcaagtggataacacctcatagcctggaagaa
cttttggcgttaaaagtccaatatcctgatgctcctcttttagtaggaaatacaagcatt
ggtcttcaaatgaaaatggaaggtattatttacccagtcattttatcagtcagtagaatt
gaagatcttaatgttgtgaaatacacaaatgatggaatatctgtgggagctgcttgcagt
ctatcagtgctgcgggataccctaaacaaagctgtcttggagcatccagaggagaagacc
aagacattttgtgcactgctccagcagctgaaaactctggctggaagacagataaagaac
atggcttctttaggtggacatgttattatcaaggattccctctctgatctgaatcctgtt
ttagcagcagccaactcgtctctacatgttctatcaaaagctggagcaagagagattcac
tgcaatgaggcctactttgaaagtatagaacatgcatcactcctgcctgaagaggtgttg
atttctgtgttgattccattttcacaaaagtgggaggttgtgtcagccttcagacaggca
cagaggaaggttaacgctgcccccatagtggtgactggaatgagagttcttttccaggag
aatacagatatcatcaaggacttaaacatattctttggaggcatacagaaaagtacacta
tgtgcaaagaaaaccagaatgggagttattggaaggcactgggatgacgagatgctgagt
gaagcttgtagattaattctggatgagattaccctgccacccacagctcagggagggatg
gtagaataccgtcggacactcaccatcagcttcttcttgaaattttacttacaggtttta
caagtactgatatcatggaatatccgtgacatggaaccatcattgagtggtgctgtttca
aaagagaacctcagtgccaaaggaagcaatatacagagatatcaggatgtttctgctgat
cagtcccatcaggataccgttggtcgaccaattatgcaccaggcagctataaaacaagtg
tctggggaggctgagtactgtgacgatatgcctgccatagatggagaactctttatggca
ctagtgaccagctcacgggctcatgcaaagatcctttctatggacctgacagaagccaag
aatatgcctggtgtctgcgacgtgataactgcaaaagatattcctgaaaccaatgacttc
tattatttcaactggccagagcaactaatggcagatgataaggttctctgtgttggatac
atcatttgtgctgtagtagctgatacccaagaacatgcaaagcaagcagctaaaaaagta
aaagtcatctaccaagatatagagccaaccattctaactattgaggatgcaataagacat
aaatccttctttgaaacagagcggaaattacaccatggaaatattgacaagggatttaaa
acagcagatcacattcttgaaggggagatttacatagggggacaagagcatttttacatg
gagacacaaagcattcgagttgtgccaagcaaagaagacaaggaaatgcatatttatgca
gcatcccaagatccatcttacatgcagggccttgttgcatcaacattgaacattccctcc
aatagggtcaactgccatgtcaaaagaattggtggggcattcgggggcaaaattacaaaa
actgctttcattgcagcaataacagctgtggctgctaggaaaaccaaacaagctatacgc
tgtgtgctggaaagggatgaagatatgttaattactgctgggcgacacccttatcttgga
aaatataaagtgggcttcacaaatgatggaagaatcacagcagcagatgtcacttactat
agtaatgccggctgctctgtgactgagtcagtctttatcatggaggcttctgtgctacag
attaataatgcctacaatatccctaatctgagatgccagggaatagtttgcaaaacaaat
ttaccatcaaatgtctcctttcgggggtttggctttcctcagtgtgctctggttacagaa
gtttggattgaggaagttgctgtcaaatgcaatttgccaacacataaggtcaaagagatc
aacatgtatcgggggaatattgtggctccttacaaacaggagttcgacacaaccaatttg
ctaaaatgctgggaggagtgtttggaaagttctgaataccatgccaggagacaatcagtt
gcacagtttaaccaacaaaatcaatgggctaaaagaggcatatccattattcctatgaag
ttcccagtttcttttactaagtcaatagaaaatcaggctgctgctttggttcatattttt
attgatgggtcagtgctagtgtctcatggaggtactgaaatggggcaaggtatccacacc
aagataatgcagattgcaagccgtgaattaggcattccaataacctacatccacatcagc
gaaaccagcacatcctctgtccccaacaccattgcttcagctgctaccgttggaactgat
gtgaatggaatggcagtcaaggatgcctgtgagaaacttcggaaacgccttaaacctatt
gttagcagaaatccttcgggtacctgggagagctggataaaggaagcttttctccaaaga
atcagtctttctgccactggatatttcagaggttatgagacatatatggactgggagaaa
ggagaaggccatccctatcagtactgtgtttttggaactgcctgttcagaagtggaagta
gactgtctaagtggagattatacgaatatcagaacagatattgttatggacattggtagc
agtataaatcctgccgtggatttgggtcagattgaaggagcatttgttcaaggcattggt
cttttcacaatggaggaactgaaatactctccagaaggagtcctgtatactcgaggacca
ggacaatataagatcccgtcagtatgtgatattcccaaacaattccatgtatcagtgctt
ccttcatcacataacccacatgctatctactcatccaagggagttggggagcctggtatc
tttttggggtcctctgtgtattttgctataaaggatgcaatgttatcggcccgaagagac
aggggattgtctgacatttttacactaaacagcccagcaaccccagagaagattcggatg
gggtgtggggacagcttcacagacatgattcctaaagacaatccagagttatttatccca
tgggctattaatgtgtag

DBGET integrated database retrieval system