KEGG   Xenopus laevis (African clawed frog): 444490Help
Entry
444490            CDS       T01010                                 

Gene name
aox1, aoh1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:xla00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xla00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:xla00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:xla00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:xla00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xla00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:xla00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1245 aa AA seqDB search
MLISYLRKTYIILLMPVWCPSALCMAWQSQQLKGLAAHPQDYIQYRNHPEPTLEQIYDTL
GGNLCRCTGYRPIVDGCKSFCKEENCCQLQENIPNLPGMEPQNSNISTQLFNKEKFSPLD
PSQELIFPPDLILMAKQHKPKTLIFHGERIKWITPHSLEELLALKVQYPDAPLLVGNTSI
GLQMKMEGIIYPVILSVSRIEDLNVVKYTNDGISVGAACSLSVLRDTLNKAVLEHPEEKT
KTFCALLQQLKTLAGRQIKNMASLGGHVIIKDSLSDLNPVLAAANSSLHVLSKAGAREIH
CNEAYFESIEHASLLPEEVLISVLIPFSQKWEVVSAFRQAQRKVNAAPIVVTGMRVLFQE
NTDIIKDLNIFFGGIQKSTLCAKKTRMGVIGRHWDDEMLSEACRLILDEITLPPTAQGGM
VEYRRTLTISFFLKFYLQVLQVLISWNIRDMEPSLSGAVSKENLSAKGSNIQRYQDVSAD
QSHQDTVGRPIMHQAAIKQVSGEAEYCDDMPAIDGELFMALVTSSRAHAKILSMDLTEAK
NMPGVCDVITAKDIPETNDFYYFNWPEQLMADDKVLCVGYIICAVVADTQEHAKQAAKKV
KVIYQDIEPTILTIEDAIRHKSFFETERKLHHGNIDKGFKTADHILEGEIYIGGQEHFYM
ETQSIRVVPSKEDKEMHIYAASQDPSYMQGLVASTLNIPSNRVNCHVKRIGGAFGGKITK
TAFIAAITAVAARKTKQAIRCVLERDEDMLITAGRHPYLGKYKVGFTNDGRITAADVTYY
SNAGCSVTESVFIMEASVLQINNAYNIPNLRCQGIVCKTNLPSNVSFRGFGFPQCALVTE
VWIEEVAVKCNLPTHKVKEINMYRGNIVAPYKQEFDTTNLLKCWEECLESSEYHARRQSV
AQFNQQNQWAKRGISIIPMKFPVSFTKSIENQAAALVHIFIDGSVLVSHGGTEMGQGIHT
KIMQIASRELGIPITYIHISETSTSSVPNTIASAATVGTDVNGMAVKDACEKLRKRLKPI
VSRNPSGTWESWIKEAFLQRISLSATGYFRGYETYMDWEKGEGHPYQYCVFGTACSEVEV
DCLSGDYTNIRTDIVMDIGSSINPAVDLGQIEGAFVQGIGLFTMEELKYSPEGVLYTRGP
GQYKIPSVCDIPKQFHVSVLPSSHNPHAIYSSKGVGEPGIFLGSSVYFAIKDAMLSARRD
RGLSDIFTLNSPATPEKIRMGCGDSFTDMIPKDNPELFIPWAINV
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgttgatctcctaccttcgcaagacatacattattctgttaatgcctgtctggtgccca
tctgctctctgcatggcatggcagtcacaacagttgaagggattggcagcacatccacaa
gattacatccagtacaggaaccatccagaacctactttggagcaaatatatgatactttg
ggaggtaatttatgccgctgcactggatacagaccaatagtggatggatgtaagagcttc
tgtaaggaggaaaactgctgccagctacaagaaaacataccaaacctgccaggaatggag
cctcagaatagtaatatctctacacagctgtttaacaaagaaaagttttcgccattggat
ccatcccaggaactgatatttccaccagacttaattttgatggcaaagcaacacaaacca
aaaactttgatttttcatggagagagaatcaagtggataacacctcatagcctggaagaa
cttttggcgttaaaagtccaatatcctgatgctcctcttttagtaggaaatacaagcatt
ggtcttcaaatgaaaatggaaggtattatttacccagtcattttatcagtcagtagaatt
gaagatcttaatgttgtgaaatacacaaatgatggaatatctgtgggagctgcttgcagt
ctatcagtgctgcgggataccctaaacaaagctgtcttggagcatccagaggagaagacc
aagacattttgtgcactgctccagcagctgaaaactctggctggaagacagataaagaac
atggcttctttaggtggacatgttattatcaaggattccctctctgatctgaatcctgtt
ttagcagcagccaactcgtctctacatgttctatcaaaagctggagcaagagagattcac
tgcaatgaggcctactttgaaagtatagaacatgcatcactcctgcctgaagaggtgttg
atttctgtgttgattccattttcacaaaagtgggaggttgtgtcagccttcagacaggca
cagaggaaggttaacgctgcccccatagtggtgactggaatgagagttcttttccaggag
aatacagatatcatcaaggacttaaacatattctttggaggcatacagaaaagtacacta
tgtgcaaagaaaaccagaatgggagttattggaaggcactgggatgacgagatgctgagt
gaagcttgtagattaattctggatgagattaccctgccacccacagctcagggagggatg
gtagaataccgtcggacactcaccatcagcttcttcttgaaattttacttacaggtttta
caagtactgatatcatggaatatccgtgacatggaaccatcattgagtggtgctgtttca
aaagagaacctcagtgccaaaggaagcaatatacagagatatcaggatgtttctgctgat
cagtcccatcaggataccgttggtcgaccaattatgcaccaggcagctataaaacaagtg
tctggggaggctgagtactgtgacgatatgcctgccatagatggagaactctttatggca
ctagtgaccagctcacgggctcatgcaaagatcctttctatggacctgacagaagccaag
aatatgcctggtgtctgcgacgtgataactgcaaaagatattcctgaaaccaatgacttc
tattatttcaactggccagagcaactaatggcagatgataaggttctctgtgttggatac
atcatttgtgctgtagtagctgatacccaagaacatgcaaagcaagcagctaaaaaagta
aaagtcatctaccaagatatagagccaaccattctaactattgaggatgcaataagacat
aaatccttctttgaaacagagcggaaattacaccatggaaatattgacaagggatttaaa
acagcagatcacattcttgaaggggagatttacatagggggacaagagcatttttacatg
gagacacaaagcattcgagttgtgccaagcaaagaagacaaggaaatgcatatttatgca
gcatcccaagatccatcttacatgcagggccttgttgcatcaacattgaacattccctcc
aatagggtcaactgccatgtcaaaagaattggtggggcattcgggggcaaaattacaaaa
actgctttcattgcagcaataacagctgtggctgctaggaaaaccaaacaagctatacgc
tgtgtgctggaaagggatgaagatatgttaattactgctgggcgacacccttatcttgga
aaatataaagtgggcttcacaaatgatggaagaatcacagcagcagatgtcacttactat
agtaatgccggctgctctgtgactgagtcagtctttatcatggaggcttctgtgctacag
attaataatgcctacaatatccctaatctgagatgccagggaatagtttgcaaaacaaat
ttaccatcaaatgtctcctttcgggggtttggctttcctcagtgtgctctggttacagaa
gtttggattgaggaagttgctgtcaaatgcaatttgccaacacataaggtcaaagagatc
aacatgtatcgggggaatattgtggctccttacaaacaggagttcgacacaaccaatttg
ctaaaatgctgggaggagtgtttggaaagttctgaataccatgccaggagacaatcagtt
gcacagtttaaccaacaaaatcaatgggctaaaagaggcatatccattattcctatgaag
ttcccagtttcttttactaagtcaatagaaaatcaggctgctgctttggttcatattttt
attgatgggtcagtgctagtgtctcatggaggtactgaaatggggcaaggtatccacacc
aagataatgcagattgcaagccgtgaattaggcattccaataacctacatccacatcagc
gaaaccagcacatcctctgtccccaacaccattgcttcagctgctaccgttggaactgat
gtgaatggaatggcagtcaaggatgcctgtgagaaacttcggaaacgccttaaacctatt
gttagcagaaatccttcgggtacctgggagagctggataaaggaagcttttctccaaaga
atcagtctttctgccactggatatttcagaggttatgagacatatatggactgggagaaa
ggagaaggccatccctatcagtactgtgtttttggaactgcctgttcagaagtggaagta
gactgtctaagtggagattatacgaatatcagaacagatattgttatggacattggtagc
agtataaatcctgccgtggatttgggtcagattgaaggagcatttgttcaaggcattggt
cttttcacaatggaggaactgaaatactctccagaaggagtcctgtatactcgaggacca
ggacaatataagatcccgtcagtatgtgatattcccaaacaattccatgtatcagtgctt
ccttcatcacataacccacatgctatctactcatccaagggagttggggagcctggtatc
tttttggggtcctctgtgtattttgctataaaggatgcaatgttatcggcccgaagagac
aggggattgtctgacatttttacactaaacagcccagcaaccccagagaagattcggatg
gggtgtggggacagcttcacagacatgattcctaaagacaatccagagttatttatccca
tgggctattaatgtgtag

DBGET integrated database retrieval system