KEGG   Xenopus laevis (African clawed frog): 444530Help
Entry
444530            CDS       T01010                                 

Gene name
cycs, cyct
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xla00920]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xla04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:xla04115]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xla05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 105 aa AA seqDB search
MGDVEKGKKVFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW
DEDTLMVYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgttgagaaaggcaagaaagtctttgtccagaaatgttcccagtgccacact
gtagaaaaaggaggcaagcacaaaactggacctaaccttcatggcctgtttggacgcaag
actggtcaagcagaaggcttttcttatactgatgctaacaaaaataagggaattgtttgg
gatgaggatacccttatggtatatctagaaaatcctaagaagtacattcctggaacaaag
atgatctttgctggcattaagaagaagggcgagagacaagacttgatagcatatctcaaa
cagtcaacctccagttaa

DBGET integrated database retrieval system