KEGG   Xenopus laevis (African clawed frog): 444530Help
Entry
444530            CDS       T01010                                 

Gene name
cycs, cyct
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    444530 (cycs)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    444530 (cycs)
   04115 p53 signaling pathway
    444530 (cycs)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    444530 (cycs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 105 aa AA seqDB search
MGDVEKGKKVFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW
DEDTLMVYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgttgagaaaggcaagaaagtctttgtccagaaatgttcccagtgccacact
gtagaaaaaggaggcaagcacaaaactggacctaaccttcatggcctgtttggacgcaag
actggtcaagcagaaggcttttcttatactgatgctaacaaaaataagggaattgtttgg
gatgaggatacccttatggtatatctagaaaatcctaagaagtacattcctggaacaaag
atgatctttgctggcattaagaagaagggcgagagacaagacttgatagcatatctcaaa
cagtcaacctccagttaa

DBGET integrated database retrieval system