KEGG   Xenopus laevis (African clawed frog): 444530Help
Entry
444530            CDS       T01010                                 

Gene name
cycs.S, cycs, cyct
Definition
(RefSeq) cytochrome c, somatic S homeolog
  KO
K08738  cytochrome c
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    444530 (cycs.S)
   04115 p53 signaling pathway
    444530 (cycs.S)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    444530 (cycs.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 444530
NCBI-ProteinID: NP_001086101
Xenbase: XB-GENE-971594
UniProt: Q6DKE1 A0A1L8FR74
Position
6S
AA seq 105 aa AA seqDB search
MGDVEKGKKVFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW
DEDTLMVYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgttgagaaaggcaagaaagtctttgtccagaaatgttcccagtgccacact
gtagaaaaaggaggcaagcacaaaactggacctaaccttcatggcctgtttggacgcaag
actggtcaagcagaaggcttttcttatactgatgctaacaaaaataagggaattgtttgg
gatgaggatacccttatggtatatctagaaaatcctaagaagtacattcctggaacaaag
atgatctttgctggcattaagaagaagggcgagagacaagacttgatagcatatctcaaa
cagtcaacctccagttaa

DBGET integrated database retrieval system