KEGG   Xenopus laevis (African clawed frog): 444542Help
Entry
444542            CDS       T01010                                 

Gene name
cyp2c8.2.L, cpc8, cyp2c8.2, cypiic8, mp-12/mp-20
Definition
(RefSeq) cytochrome P450, family 2, subfamily C, polypeptide 8, gene 2 L homeolog
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00140  Steroid hormone biosynthesis
xla00590  Arachidonic acid metabolism
xla00591  Linoleic acid metabolism
xla00830  Retinol metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    444542 (cyp2c8.2.L)
   00590 Arachidonic acid metabolism
    444542 (cyp2c8.2.L)
   00591 Linoleic acid metabolism
    444542 (cyp2c8.2.L)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    444542 (cyp2c8.2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     444542 (cyp2c8.2.L)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP2 family
   444542 (cyp2c8.2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 444542
NCBI-ProteinID: NP_001086113
Xenbase: XB-GENE-5852319
UniProt: Q6GM73
Position
8S
AA seq 495 aa AA seqDB search
MEPMTMFLCLSIFLLSLLTWKIHKKRLQLPPGPFPLPLLGNVLQGTTVLYDSYRKFYEKY
GPVFTIWQGSTPLVVLCGYEALKDALINQSQEFGDRGIFALSGRLTNGYGVLNTNGERWQ
QLRRFSITVFRNFGMGKRSMEERIQEEARHLIQAVQDTGGKPFNPVHLLGRAVNNIINLT
VFGRSWGYEDKTLLKLVNVLNNILLFIRTPLGVIYAAFFKIMRHLPGPHQKIFHDSEIVK
SFIREQIQFHRDTLDSNSPRDYIDCFLIKADQEKDLHSSEFSQENLVNTVFELFLAGTET
TANTMQFSLLAIITYPHIQERVQKEIDQVVGSDRLPGIADRPQMPYTNAVIHEIQRFLDL
APLALPHMVTQDTVFKGFRLLKGTTVIPLIGSALRDPAHWETPEEFNPEHFLNQNGEFYM
CPAFMPFSAGKRVCLGEGLARMEIFLFFTGLLQKFTFTSANQTDTFDLRTLRRAFRKKGL
VYKLRAIPRTCTLKN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagccaatgaccatgttcctctgtctttccattttcttactttcactcctgacatgg
aagatacacaagaaacgacttcaactgcccccgggaccctttcctcttccgctgctggga
aatgtgctacaggggaccactgtgctctatgactcttatcgcaagttttatgaaaagtac
ggcccagtgttcactatatggcaaggttccacaccgctggtggtactctgtgggtatgag
gcactgaaagatgctttgatcaaccaatctcaggaatttggtgaccgtgggatctttgca
ctgtctgggaggttaaccaatggatatggtgtccttaacacaaatggagaacgttggcag
cagttgcgtcgcttttcaatcactgtatttagaaactttggaatggggaagcggtccatg
gaagagagaatacaagaggaggctcggcaccttatacaggctgtacaggacacaggaggg
aagccatttaatcctgtccatttacttggacgagcggtaaacaacattattaatttaaca
gtgtttggaagaagctggggctacgaagataagacacttcttaagctggtcaacgtgttg
aataacatccttctcttcatcagaaccccattaggagtgatatatgctgccttcttcaag
atcatgcggcacctgccgggcccacaccaaaagatattccatgacagtgagatagtgaaa
tctttcatcagagagcagattcagtttcacagggacacactggattccaattccccacgg
gattatattgactgcttcctcatcaaagctgatcaggaaaaggacctgcactcaagtgaa
ttcagccaagaaaatctggtgaacacagtgtttgagttatttttagccggaacagagacc
actgcaaatactatgcagttcagcttgttggccattattacatacccccatattcaagaa
cgggttcagaaggagatagaccaagtagttggatcagatcgactgcctgggatagcagac
agaccccagatgccatacactaatgccgttattcatgagattcaaaggttcttggatctt
gctccactggcccttccacacatggtaacacaggacacagtatttaaaggtttcagactc
ctcaagggaaccacagtcattccattaattggctcagccctaagggacccggcacactgg
gaaacaccggaggaattcaatcctgaacacttcctaaaccagaatggagagttttatatg
tgcccagcattcatgccattctcagcaggaaagagagtgtgtctgggagaaggactggct
cgtatggaaatcttcctcttcttcactggactgctccagaaattcacattcacatctgca
aatcagactgatacatttgacttaaggacactgagaagggccttccggaaaaaagggctt
gtctataaattgagagccattcctaggacctgtactctgaagaactaa

DBGET integrated database retrieval system