KEGG   Xenopus laevis (African clawed frog): 444586Help
Entry
444586            CDS       T01010                                 

Definition
MGC84034 protein
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     444586
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S8: subtilisin family
   444586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 639 aa AA seqDB search
MREGVVTVWILAALVLHLASLLVSAGRPVLTHHFLVDLREGGEAEAKQLAAEYGFSGTRK
LPFTQSSYHFYGNGITKSRHRRSVNKKKHLAVDPKVNKVVQQEGFHRKKRGYRDINDIDI
NVNDPLFTKQWYLVNTGQADGTPGLDLNVAEAWELGYTGRGVTIAIMDDGIDYLHPDLAS
NYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIR
MLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRGG
KGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGR
KRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALTLEANPGLTWRDLQHLTVLTSKR
NKLHDEVHKWRRNGVGLEFNHLFGYGVLDAGAMVKMAKEWKTVPERFHCIGGAIQEPRKI
PSDGKLILTLSTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSILLSRR
PRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFVGSMPEKGVLKEWTLMLHGTQSAPY
IDQIVRDYQSKLAMSKKEELEEELDEAVQRSLKSLLSKN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaggtgttgtgaccgtgtggattctcgctgctcttgttctgcatcttgccagt
ctcttagtctccgctggaagacctgtcctcacccatcatttcttggttgacttacgtgaa
ggaggagaagctgaagccaagcaacttgcagccgaatatggcttcagtgggacacgaaag
ctaccttttacccaaagttcataccatttttatggaaatggaatcaccaagtcccgtcat
cggcgcagtgtcaataaaaagaaacatctagccgtggatcccaaggtaaataaagtggtg
caacaagaaggtttccacaggaaaaaacgaggatacagagacatcaatgatattgacatc
aacgtgaatgatccattattcacaaaacagtggtacttggtcaatacaggccaagctgat
gggacacctggactcgatctaaatgttgctgaagcctgggagctgggatacacaggaaga
ggagttaccatagcaattatggatgatggaattgattatctgcatccagatcttgcctca
aactacaatgcagaagcaagctatgacttcagcagcaatgatccctacccataccctcgt
tatacagatgactggttcaacagccacgggacccgatgtgcaggagaagtatcagctgct
gccaataataatatatgtggtgttggagtggcttataattccaaagtggcaggcattcga
atgctggaccagcccttcatgactgatataatagaagcttcatccatcagccacatgccc
caggttatagacatatacagtgcaagctggggtccaactgatgatggcaagacggttgat
ggaccaagagaactaacattacaggcaatggcagatggagtgaataagggtcgtggtggg
aagggaagcatctacgtctgggcttctggagatggggggagttatgatgactgcaactgt
gatggttatgcatcaagcatgtggactatttccataaactccgccattaatgatggacgc
actgccctgtatgatgaaagctgctcctcaactctggcctccactttcagcaatggtaga
aaaagaaatccagaggctggcgtggctacaacagacttgtatggaaactgcactttgcgt
cattcgggaacatctgcagccgcaccagaagcagctggagtatttgcattgaccctggag
gctaacccaggtctgacatggagggacttgcagcatctgacagtgttaacatcgaaaagg
aataagcttcatgatgaagtgcacaaatggcgtagaaacggagtcggcttggagttcaat
catttgttcggctatggcgttcttgatgctggagccatggtgaaaatggccaaggaatgg
aaaacggttccagagaggtttcattgcattgggggagccatacaagagccaagaaaaata
ccttctgatgggaagctgatccttactctttcaactgatgcctgtgaaggaaaggaaaac
tttgttcgctacttggagcatgttcaagcagttataactgtcaattccacacggcgagga
gacttgaacatcaacatgacatcaccgatgggaactaagtccattttattaagtcgtcgt
cctagggatgacgactcaaaggttggttttgataaatggccgttcatgacaacacacacg
tggggggaagatccaagagggacttgggttctagaagttgggtttgttgggagcatgcca
gagaaaggtgttttgaaagaatggacactgatgttacatggcacgcaaagtgctccctat
atagaccaaatagttagagattatcagtctaaattagcaatgtccaagaaagaagagctg
gaggaggaactagatgaagcagtacaaagaagtctcaagagcctgttaagcaagaactag

DBGET integrated database retrieval system