KEGG   Xenopus laevis (African clawed frog): 444677Help
Entry
444677            CDS       T01010                                 

Gene name
paics.1, ade2, airc, pais
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase, gene 1
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    444677 (paics.1)
Enzymes [BR:xla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     444677 (paics.1)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     444677 (paics.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 425 aa AA seqDB search
MESYLDLKLGKKLNEGKTKEVYELPEHYGCVLMKSKDQITAGDAVRKDHMEGKASISNKT
TSCVFKLLQEAGIKTAFVRKCGDTAFIATHCEMIPIEWVCRRIATGSFLKRNPGVKEGYK
FLPPKVETFFKDDANHDPQWSEEQLISAKLSCGGLVIGQAEVDIMTHSTAAIFEILEKAW
MSQECTLVDMKIEFGVDVTKKEIVLADVIDNDSWRLWPAGDKSQQKDKQTYRDLKEVTAE
ALQMVKRNFEWVADRVELLLTSKSQGRVVVLMGSISDLAHCEKIKKSCANYGLPCELRVT
SAHKGPDETLRIKSEYEGDGMATVFIAVAGRSNGLGPVMSGNSAYPVINCPPLTADWAAQ
DVWSSLRMPSGLGCSTVLSPEAAAQFAAQIFGLNNHLVWSKLRSCTLNTWISLKQADMKL
RECSI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctacttagacctgaagctgggcaagaaattaaatgaagggaaaacgaaagag
gtgtatgaattgcccgagcactatggctgcgtgctgatgaagtccaaagaccagattact
gccggcgacgcagtacggaaagatcacatggaaggaaaagcctccatttccaacaagaca
actagctgcgtcttcaaactgctgcaggaggctgggatcaaaactgcgtttgtccgaaag
tgcggcgacacggctttcattgctacccactgcgagatgatacccattgagtgggtgtgc
cgaagaatcgccactggctcattcttgaagagaaatccgggtgttaaggaaggctacaaa
ttcctcccccctaaagtggagaccttttttaaggatgatgccaaccatgatcctcagtgg
tctgaggaacaactgatctctgcaaaactcagctgtggagggcttgtgattggtcaggct
gaagtggatatcatgactcattccacagcggccatctttgagattctagagaaagcttgg
atgagccaggagtgcacactagtagacatgaagattgagtttggtgtggatgttacaaag
aaggagattgtcctcgctgatgttattgataatgactcttggcgtctgtggccggctggt
gacaagtcccaacagaaagataagcaaacatatcgggacctaaaggaggtaacggctgaa
gctctgcagatggtgaagagaaattttgagtgggtggcagacagagtagagctgctgctg
acttccaaaagccagggtagggtggtggtgctgatgggatccatttctgatctggcacac
tgtgagaagattaagaaatcctgtgcaaactatggccttccctgtgagctgagagtgact
tctgcacacaaaggccccgatgaaaccctgcggatcaagtcagagtatgaaggtgatggc
atggctacagtgtttatagcagtggccggcagaagcaatggtttgggaccggtcatgtct
ggaaactctgcttatcccgtaattaactgccctcctctcactgcagactgggctgcacag
gatgtctggtcttccctccgaatgcccagtgggcttggatgttccaccgttctctcgcca
gaagctgcagctcagtttgctgctcaaatcttcggcttaaacaaccacctagtgtggtcc
aagttacgctcctgcactcttaacacctggatatctctcaagcaagccgacatgaagctg
agggagtgcagcatctga

DBGET integrated database retrieval system