KEGG   Xenopus laevis (African clawed frog): 444738Help
Entry
444738            CDS       T01010                                 

Gene name
abhd6.L, abhd6, abhd6-a, abhd6-b
Definition
(RefSeq) abhydrolase domain containing 6 L homeolog
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     444738 (abhd6.L)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S33
   444738 (abhd6.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 337 aa AA seqDB search
MDLDVLNMFLVAGGTLLVPILAFVTSFLLWPAALIKIYYWYWRRALGMQVKFSSYGNYKF
CYTSRGKPGNKASVLMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSALDDYS
ICGQVKRIHQFVESIGLNKRTFHLVGTSMGGNVAGVYAAQHPTDISSLTLICPAGLMYPT
ESKFLKHLKGLEKSGDDQRILLIPSTAGEMEDMLRLCSFVRFKIPQQVLQGLVDVRIPHN
EFYRQLFMALVNEKSRHSLQENMNKIVAPTQIIWGKQDQVLDVSGAEVLAGSIRGCQVEI
LENCGHSVVMERPRKSAKLMTDFLSSLQSTENNKKHE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatttagatgtactaaacatgttcctggtggcgggagggaccctccttgtccctatt
ttggctttcgtgacctccttcctcttgtggccggctgcgctcatcaagatttattattgg
tactggcgccgggccctggggatgcaggttaaattttccagctatgggaactataaattc
tgctacacgtcccgcgggaagccgggaaacaaggcgtcagtcctgatgctccacggattc
tctgcccataaggacatgtggctgtcggtggtgaagttccttcccaagaaccttcacctg
gtgtgtgtggatatgccaggccacgagggcaccacccgttctgcattagacgactactcc
atctgtgggcaagtgaagaggatacaccagtttgtggaaagcatcggactgaacaagagg
actttccatttggtcggcacctcgatgggggggaatgtggcaggtgtttatgccgcccag
cacccaactgatatcagcagcctcaccctcatctgtcctgcaggtttgatgtatccaacc
gagagtaagttcctaaaacacctgaagggcctggaaaaatctggcgacgaccagaggatc
ctgctcatcccgtccacagccggagaaatggaggacatgctgagactctgctcttttgtt
cgcttcaagatcccccagcaggtcctgcaggggctcgttgacgtgcgcattccccataat
gaattttacagacaattgtttatggctcttgtcaatgagaagtcgagacacagtttgcag
gaaaacatgaacaaaattgtggctcccactcagataatctggggcaaacaagaccaggtt
ctggatgtatctggggctgaggttttggccggttctatccgcgggtgccaagtagagatt
ctggagaactgcggccactcagtagtgatggaaaggcccaggaaaagcgccaaactcatg
acggacttcttgtcttcacttcagagcacagagaacaacaagaaacacgaatag

DBGET integrated database retrieval system