KEGG   Xenopus laevis (African clawed frog): 444744Help
Entry
444744            CDS       T01010                                 

Definition
MGC84775 protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    444744
Enzymes [BR:xla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     444744
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   444744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MQVDSILHSGYFHPVLRAWQSTATSLDANNLMYPIFITDNPDAIEDIPSLPGQARYGVNQ
LEGLLRPLVDNGLKCVLIFGVPSRVTKDDRGSAADADDTPAILAIRRIREKFPQLLVACD
VCLCPYTSHGHCGILREDGSIQNESSCQRLAEVALAYARAGCHIVAPSDMMDGRIGAIKQ
ALISNNLGNKVSVMSYSAKFASCFYGPFRDAAQSKPAFGDRKCYQLPPGARGLAIRAVDR
DVREGADMLMVKPGMPYLDLVRDVKNKHPALPLAVYHVSGEYAMLWHGAQANAFDLKVAV
LEAMTGFRRAGADIIITYYTPQLLNWIKER
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtggactccatcctacacagtgggtatttccaccctgtgctccgggcctggcag
agcacggctaccagccttgatgccaacaacctcatgtaccccatctttatcacggacaac
ccagatgccattgaggacattcccagcctgccgggccaagccaggtatggggtcaaccaa
ttggaaggcctgctgcgccctctggtggacaatggcctaaagtgtgtgctgatctttggg
gtcccaagcagagtcactaaggacgaccgtggctccgcagcagatgcagacgacacaccg
gccatactggccatacggaggattcgggaaaagttcccccagctgctcgttgcctgtgac
gtttgtctttgtccctatacatcccatgggcactgtgggattctacgggaagatggcagc
atacagaatgagagcagttgccagagattagcagaagtggcccttgcttatgcccgggca
ggctgtcacatcgtggcaccttcagacatgatggatggacgaattggagcgataaagcag
gcgctgatctccaacaacctggggaacaaggtgtccgtcatgagttacagtgccaagttt
gcctcctgtttctatgggccatttagggatgccgcacagtccaaacctgcctttggcgat
cggaaatgctaccagcttccacctggtgccaggggcctggccattcgggcagtggaccgg
gatgtgcgtgaaggggcagacatgctaatggtaaagccgggaatgccatatctggatctg
gtcagagacgtcaagaataagcaccctgctctcccactggctgtgtaccacgtgtctggg
gaatatgccatgctgtggcatggagcacaggctaatgcttttgacctcaaggtggctgta
ctggaagcaatgaccggattccggagagcaggagcggatatcatcattacctactacacc
ccccagctcctcaactggataaaggaaagataa

DBGET integrated database retrieval system