KEGG   Xenopus laevis (African clawed frog): 444804Help
Entry
444804            CDS       T01010                                 

Definition
MGC82148 protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    444804
   04310 Wnt signaling pathway
    444804
   04370 VEGF signaling pathway
    444804
   04020 Calcium signaling pathway
    444804
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    444804
   04210 Apoptosis
    444804
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     444804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagcaagctatccactggaaatgtgctcgcatttcgatgcggatgagatc
aaaaggctggggaaaaggttcaagaaactggatttagacaactctggttccttgagtgtg
gaggagttcatgtctttgccagagcttcaacagaaccctcttgtacagcgagtaatagac
atatttgatacagatggaaatggagaagtagacttcaaagagttcatcgaaggagtgtcc
cagttcagcgtcaaaggtgacaaggagcagaaactgaggtttgctttccgtatatatgac
atggacaaggatggctacatctccaatggtgagctcttccaggtactgaagatgatggtg
ggaaacaatctcaaagacactcagttacagcaaatagtagacaaaaccattatcaatgca
gataaagatggagatggaagaatatcttttgaagaattctgtgctgtcgtaggaggctta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system