KEGG   Xenopus laevis (African clawed frog): 445821Help
Entry
445821            CDS       T01010                                 

Gene name
rps6ka1, hu-1, mapkapk1a, rsk, rsk1
Definition
ribosomal protein S6 kinase, 90kDa, polypeptide 1 (EC:2.7.11.1)
Orthology
K04373  
p90 ribosomal S6 kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    445821 (rps6ka1)
   04150 mTOR signaling pathway
    445821 (rps6ka1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    445821 (rps6ka1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    445821 (rps6ka1)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     445821 (rps6ka1)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   445821 (rps6ka1)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     445821 (rps6ka1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 733 aa AA seqDB search
MPLAQLVDLWPEVELVHEDTENGHGGPEDRGRHTSKDEVVVKEIPITHHVKEGAEKADQS
HFVLLKVLGQGSFGKVFLVRKITPPDANQLYAMKVLKKATLKVRDRVRTKMERDILADVH
HPFVVRLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HGADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSNEAQSLLRALFKRN
ATNRLGSGVEGAEELKRHPFFSTIDWNKLYRRELSPPFKPSVTQPDDTYYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVAPVLVEEDAKKTSSPPVLSVPKTHSKNVLFTDVYTVRE
TIGVGSYSVCKRCVHKGTNMEYAVKVIDKSKRDPSEEIEILRRYGQHPNIITLKDVYEEC
NSIYLVTELMRGGELLDRILRQKFFSEREACSVLFTVCKTVEYLHSQGVVHRDLKPSNIL
YVDESGDPESIRICDFGFSKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGI
LLYTMLAGYTPFANGPGDTPEEILARIGSGKFTLRGGNWNTVSAAAKDLVSRMLHVDPHQ
RLNAKQVLQHEWITKRDMLPQSQLNRQDVHLVKGAMAATYSALNSSKPTPQLQPIKSSVL
AQRRVKKLPSITL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggcacaactggtggatctttggcccgaggtggagctggttcatgaggacacg
gagaacggacatggaggtccggaagatcgtgggcggcatacctctaaggatgaggtggtg
gttaaagaaatcccgatcactcaccatgttaaagaaggtgctgagaaggctgatcaatca
cattttgttctactcaaagtgctaggacagggctcttttggaaaggttttcctggtccgc
aaaataactccacctgacgccaaccagctctatgccatgaaagtactgaaaaaggccaca
ctgaaagtgcgtgaccgagttagaaccaagatggagcgagatattctagctgatgtgcac
catccgtttgttgtaaggttacactatgcttttcagactgaggggaaactttacttaatc
ctggattttctgcggggaggagatctatttacacgtctgtccaaggaggtgatgttcaca
gaagaagatgtgaagttttaccttgctgaattggctttgggccttgatcatttgcacagc
ttagggatcatctaccgtgacctaaaacctgaaaacattctcttggatgaagagggccat
ataaagcttacagattttggacttagtaaagaagcaatagaccatgaaaaaaaggcttat
tctttttgtgggactgtggagtacatggctcctgaagtggtaaatcgacagggacactca
cacggtgcagactggtggtcttatggagtgcttatgtttgagatgctgacaggatccctg
ccattccagggcaaagaccgtaaggaaactatgactctaatcctaaaagccaaactaggg
atgcctcagtttcttagcaatgaagcacagagtctattacgtgctctgttcaaaaggaat
gctactaaccgtttaggttctggtgttgaaggggctgaagagcttaagcgacatcctttc
ttctcaaccattgattggaataaattataccgccgggagttgagcccacccttcaaacca
tcagttacccagccagatgatacctattactttgacacagagtttacatcacggactccg
aaagactctcctggtataccacctagtgctggggcccaccagctctttcgagggtttagt
tttgtggctccagtattggtagaggaagatgcaaaaaaaacaagcagtcctcctgtactt
tcagtgccaaagacacacagtaaaaatgttcttttcacggacgtgtacactgtgcgggaa
actattggtgttggatcatactctgtatgcaagcgatgtgttcataagggaaccaacatg
gagtatgctgtaaaggtgatagacaaatcaaagagagacccatcagaggaaattgagata
ttgaggagatatggacagcaccccaacatcattaccttaaaagatgtttatgaagagtgt
aacagcatctaccttgtaacagagttgatgcgaggtggggagctcctggaccgcatacta
agacaaaagtttttctctgaaagagaagcctgctctgtcctttttaccgtctgcaagaca
gtggagtatttacactctcaaggggtagttcatagagacctgaaacctagcaacattctg
tatgtggatgaatccggtgatccagagtcaatcaggatatgtgacttcggattctctaaa
cagctacgagcagagaatggcttgctcatgactccatgctacacggccaattttgttgca
ccagaggtattaaaacgacagggctatgatgagggctgtgatatctggagcttaggcatt
ctcctttatactatgcttgcaggatacacaccatttgcaaatggaccaggagacacgcct
gaagagatactagctcgtattggtagtgggaagtttacactgaggggtggaaactggaat
actgtgtctgccgctgcaaaggacttggtttcacgaatgctgcatgtagaccctcatcag
aggctcaatgctaaacaagttctacagcatgaatggatcacaaaaagagacatgttaccc
cagagccaactgaaccgacaggatgtacatctagtaaaaggagctatggcagcaacatac
tctgccttaaatagctcaaagccaacacctcagctgcagccaattaaatcatctgttctg
gcacaacggcgggtcaagaagctaccttctattactctttag

DBGET integrated database retrieval system