KEGG   Xenopus laevis (African clawed frog): 446302Help
Entry
446302            CDS       T01010                                 

Gene name
dyrk1a, mnb
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     446302 (dyrk1a)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   446302 (dyrk1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 750 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMSHSHQQYSDRHQQNLNDQQASALPYN
DQTPQPLPNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSS
HKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIK
IIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDL
LRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDF
GSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGANEVD
QMSKIVEVLGIPPAHILDQAPKARKFFEKMPEGTWNLKKTKDGKKEYKPPGTRKLHNILG
VENGGPGGRRAGESGHTVADYLKFKDVILRMLDYDAKTRIQPYYALQHSFFKKTADEGTN
TSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTTAVAM
DCETHSPQVRQQFPPGWTVPEAPTQVTIETHPVQETTFHVPPSQKNVPHHHGNGSHHHHH
HHHHHHGQHILSNRTRTRIYNSPSTSSSTQDSMDIGNSHHSMTSLSSSTTSSSTSSSSTG
NQGNQAYQNRPVAANTLDFGQNGTLDVNLTVYSNPRQETGITGHPDYQYSANTGPGHYVT
EGQLTMRQGIDREDSPMTGVCVQQSPVASS
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccatcatctgtccggcttgcaccatcc
ttttcattccatgctgccggccttcagatggctggacaaatgtcccattcacatcagcag
tacagtgaccgccatcagcagaacctaaacgaccaacaagcatctgccttaccatacaat
gaccagactccgcaaccgttgcctaaccagcggcggatgccacaaacatttcgcgatcca
gccacagcaccattgagaaaactgtcagtcgacttgatcaaaacatacaaacatattaat
gaggtctactatgcaaaaaagaaacggcggcatcagcaaggacaaggggatgactccagt
cataagaaggagaggaaggtttacaatgatggctatgatgatgacaactacgactatatt
gttaaaaatggtgaaaaatggatggatagatatgaaatcgattctttaattggcaaaggg
tcattcggccaggttgtaaaggcatatgatcgcgtggagcaagagtgggtggcgattaaa
attataaagaacaagaaagctttcttaaaccaagcccaaattgaagtccggcttctcgag
ctgatgaacaaacatgacacggaaatgaagtactatatcgtgcatttaaagcggcatttt
atgttcagaaaccacctttgtttagtgtttgaaatgctctcgtacaacctctacgattta
ctgcgcaacaccaatttccgtggcgtttctctcaacctgacacgaaagtttgcacagcag
atgtgcactgcactactcttcctggcgactccagaacttagtatcattcactgtgacctg
aagcccgagaatatcttgctttgtaacccaaaacgaagcgctattaagattgttgacttt
ggaagctcgtgccaacttgggcaaaggatttaccagtatattcaaagtcgcttctatcgg
tctcctgaggttttactaggaacgccttatgacctggcaattgacatgtggtcccttggg
tgcattttggtagaaatgcatactggagaacccctgttcagtggagccaatgaggtcgat
caaatgagtaaaattgtggaagttttaggaataccacctgcccacattcttgaccaagca
ccaaaagctagaaagttctttgagaagatgccagagggcacttggaacttaaagaagacc
aaagatgggaaaaaggagtacaaaccaccgggaacccgaaaacttcacaacatacttgga
gtagaaaatggaggaccgggtggccgccgtgctggggaatcaggtcatactgtagcggac
tacttgaagtttaaagacgtcattttaaggatgttggattatgatgccaagacccgtatc
caaccatattatgctctgcaacatagtttctttaagaaaactgctgacgaaggtacaaac
acaagtaacagtgtatcaacgagtccagcaatggagcagtcgcagtcgtcaggaaccacc
tctagcacatcatctagttcaggtggctcatctggtacaagcaacagtggaagagcaagg
tctgaccctacacatcaacatcgacacagtggtggccattttacaacggcggtggctatg
gattgtgagacgcacagtcctcaggttcgacagcagtttcctcctggttggacagtccct
gaagctcctacgcaggtcaccattgaaacacaccccgtgcaagaaactacatttcatgta
cccccttcccagaaaaatgtaccgcatcaccatgggaatggctcccaccatcatcatcac
caccaccatcaccaccatggacagcatatcttgagtaacaggacgaggaccaggatctac
aattctccatcaactagctcctccacccaggattctatggatattggtaatagccaccac
tccatgacatccttgtcttcctcaactacttcttcctcaacatcttcctcttctactggc
aaccaaggcaatcaggcctaccaaaatcgtcctgtggctgctaacaccttggactttgga
cagaatggaactttggatgttaatttaactgtctattcaaatcctcgccaagagactggc
atcactggacatccagattaccaatattctgcaaatacaggccctggccattacgtaacg
gaaggacaattaacgatgaggcaagggattgaccgagaagactctcccatgacaggagtt
tgtgttcagcagagtcctgtggcaagctcgtga

DBGET integrated database retrieval system