KEGG   Xenopus laevis (African clawed frog): 446356Help
Entry
446356            CDS       T01010                                 

Gene name
gbe1
Definition
glucan (1,4-alpha-), branching enzyme 1 (glycogen branching enzyme, Andersen disease, glycogen storage disease type IV)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    446356 (gbe1)
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     446356 (gbe1)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   446356 (gbe1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 688 aa AA seqDB search
MATEGKEVQVEVPELDVLLEQDPYLKLYEKDFRRRYGLYTQLLKSIEGNEGGLEKFSRSY
QSFGIHVLANGGICCKEWAPGAEAVFLTGDFNGWNPFSHPYKKMDYGKWELHIPPREDNS
VIIPHGSKLKVVITSKSGETLYRISPWAKYVVREDKKAVYDWVHWEPLQPYKRKYATPKK
LKSVRIYESHVGIASPEGRIASYKNFTYNVLPKIKDLGYNCIQMMAVMEHAYYASFGYQV
TSFFAASSRYGTPDELKELIDVAHSMGIQVLLDVVHSHASKNSEDGLNKFDGTESCFFHD
GARGNHDLWDSRLFDYSNWEVLRFLLSNLRWWMEEYGFDGFRFDGVTSMLYHHHGIGCGF
TGDYNEYFGLQVDEESLVYLMLANHMLHTLYPDCITVAEDVSGMPALCCPISQGGAGFDY
RLAMAVPDKWIQILKELKDEDWNMGNIVHTLINRRYNEKCIAYAESHDQALVGDKTLAFW
LMDAEMYTNMSVLSPLTPVIDRGIQLHKMLRLITHGLGGEGYLNFIGNEFGHPEWLDFPR
KGNGESYHYARRQFHLIDDQLLRYRFLYAFDRDMNNLEEKFGWLAAPQAYISAKHEGDKI
IVFERANLLFIFNFHPYKSFTGYRVAVNTPGKYMIALDTDASEYGGHQRINHSTEFFTED
APYNNRSHSLLVYIPCRVALVLRNVNYS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaggaaaggaggtgcaggtggaagtgccggagctggacgtgctgttggag
caggacccgtacctcaagctgtacgagaaagacttccgcagaaggtacggtttatatacc
caactcttgaaaagcattgaaggaaatgaaggaggtttggaaaagttttccagaagttac
caatcgtttggcattcacgtacttgcaaatggtgggatttgttgtaaagaatgggctcct
ggagctgaagcggtgttccttactggagattttaatggttggaaccctttttcacatcca
tataaaaaaatggattacgggaaatgggaactacatattccaccccgggaagataattct
gtgatcattcctcatggatcaaagctgaaggttgtgatcactagtaaatctggagaaact
ctgtaccgcatatctccttgggcaaaatatgtggttcgggaagataagaaagctgtgtat
gactgggtacattgggaacctctacagccttacaaacgcaaatatgctacccccaaaaag
ctaaagagtgtgcgcatatatgaatctcatgttggaattgcatcaccagaaggaagaatt
gcttcatataaaaactttacctataatgttctgccaaaaataaaagatcttggttataac
tgcatacaaatgatggctgttatggagcatgcatattatgcaagttttggttatcaagtc
accagcttctttgcagcttcaagtcgctatggtactccagatgagttgaaagaactgatt
gatgtcgctcactcaatgggaatccaagtccttcttgatgttgtacacagtcatgcatca
aaaaatagtgaagacggtctcaacaaatttgatggcacagagtcctgcttttttcatgat
ggggctcgaggaaaccatgatctttgggatagcagactttttgactactcaaactgggaa
gttttaaggttccttctatcaaatttgcggtggtggatggaggagtatggatttgacggg
ttccgatttgatggtgttacatccatgttatatcaccaccatggtataggttgtggtttt
actggagattataatgaatattttggacttcaggtggatgaagaatctctggtgtacctt
atgttggcaaatcacatgttgcatacactttatccagattgcattacagtagctgaggat
gtgtcaggaatgccagcactttgctgccctatatctcaaggtggtgctggatttgattac
cgacttgcaatggctgtgccggacaaatggattcagatcttaaaagagctgaaggatgaa
gactggaacatgggtaatatagtgcacacattaatcaatagacgatataatgagaaatgt
atcgcctatgcagaaagccatgatcaggcacttgttggagataagacattagcattttgg
ttaatggatgcagagatgtacacaaacatgagtgtattgtcacccttgactccagtgatt
gatcggggaattcagctccataaaatgctgcgtctgatcactcatggtcttggcggtgaa
ggctatctaaatttcataggtaatgagtttgggcatccagaatggttagatttcccaagg
aaaggaaatggagaaagctaccattatgccaggaggcaatttcatttaattgatgatcaa
ctgcttcgctatagatttctttatgcttttgacagagatatgaataatctagaagagaag
tttggatggcttgctgcaccacaggcttatatcagtgcaaagcatgaaggtgataagatc
attgtatttgaaagggcaaatcttcttttcatctttaatttccatccatacaaaagcttt
actggatacagagttgctgtgaacacacctgggaagtatatgatcgctctcgataccgat
gcttctgaatatggcgggcatcaaaggataaaccattcaactgagtttttcacagaggat
gcaccttataacaatcgttcacattcgcttttggtctacattccatgcagggttgctctt
gttcttcgcaatgttaattactcctaa

DBGET integrated database retrieval system