KEGG   Xenopus laevis (African clawed frog): 446356Help
Entry
446356            CDS       T01010                                 

Gene name
gbe1.L, gbe, gbe1
Definition
(RefSeq) glucan (1,4-alpha-), branching enzyme 1 L homeolog
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00500  Starch and sucrose metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    446356 (gbe1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     446356 (gbe1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   446356 (gbe1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_66 hDGE_amylase GHL6
Motif
Other DBs
NCBI-GeneID: 446356
NCBI-ProteinID: NP_001086521
Xenbase: XB-GENE-17331157
UniProt: Q6DFJ1
Position
2L
AA seq 688 aa AA seqDB search
MATEGKEVQVEVPELDVLLEQDPYLKLYEKDFRRRYGLYTQLLKSIEGNEGGLEKFSRSY
QSFGIHVLANGGICCKEWAPGAEAVFLTGDFNGWNPFSHPYKKMDYGKWELHIPPREDNS
VIIPHGSKLKVVITSKSGETLYRISPWAKYVVREDKKAVYDWVHWEPLQPYKRKYATPKK
LKSVRIYESHVGIASPEGRIASYKNFTYNVLPKIKDLGYNCIQMMAVMEHAYYASFGYQV
TSFFAASSRYGTPDELKELIDVAHSMGIQVLLDVVHSHASKNSEDGLNKFDGTESCFFHD
GARGNHDLWDSRLFDYSNWEVLRFLLSNLRWWMEEYGFDGFRFDGVTSMLYHHHGIGCGF
TGDYNEYFGLQVDEESLVYLMLANHMLHTLYPDCITVAEDVSGMPALCCPISQGGAGFDY
RLAMAVPDKWIQILKELKDEDWNMGNIVHTLINRRYNEKCIAYAESHDQALVGDKTLAFW
LMDAEMYTNMSVLSPLTPVIDRGIQLHKMLRLITHGLGGEGYLNFIGNEFGHPEWLDFPR
KGNGESYHYARRQFHLIDDQLLRYRFLYAFDRDMNNLEEKFGWLAAPQAYISAKHEGDKI
IVFERANLLFIFNFHPYKSFTGYRVAVNTPGKYMIALDTDASEYGGHQRINHSTEFFTED
APYNNRSHSLLVYIPCRVALVLRNVNYS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaggaaaggaggtgcaggtggaagtgccggagctggacgtgctgttggag
caggacccgtacctcaagctgtacgagaaagacttccgcagaaggtacggtttatatacc
caactcttgaaaagcattgaaggaaatgaaggaggtttggaaaagttttccagaagttac
caatcgtttggcattcacgtacttgcaaatggtgggatttgttgtaaagaatgggctcct
ggagctgaagcggtgttccttactggagattttaatggttggaaccctttttcacatcca
tataaaaaaatggattacgggaaatgggaactacatattccaccccgggaagataattct
gtgatcattcctcatggatcaaagctgaaggttgtgatcactagtaaatctggagaaact
ctgtaccgcatatctccttgggcaaaatatgtggttcgggaagataagaaagctgtgtat
gactgggtacattgggaacctctacagccttacaaacgcaaatatgctacccccaaaaag
ctaaagagtgtgcgcatatatgaatctcatgttggaattgcatcaccagaaggaagaatt
gcttcatataaaaactttacctataatgttctgccaaaaataaaagatcttggttataac
tgcatacaaatgatggctgttatggagcatgcatattatgcaagttttggttatcaagtc
accagcttctttgcagcttcaagtcgctatggtactccagatgagttgaaagaactgatt
gatgtcgctcactcaatgggaatccaagtccttcttgatgttgtacacagtcatgcatca
aaaaatagtgaagacggtctcaacaaatttgatggcacagagtcctgcttttttcatgat
ggggctcgaggaaaccatgatctttgggatagcagactttttgactactcaaactgggaa
gttttaaggttccttctatcaaatttgcggtggtggatggaggagtatggatttgacggg
ttccgatttgatggtgttacatccatgttatatcaccaccatggtataggttgtggtttt
actggagattataatgaatattttggacttcaggtggatgaagaatctctggtgtacctt
atgttggcaaatcacatgttgcatacactttatccagattgcattacagtagctgaggat
gtgtcaggaatgccagcactttgctgccctatatctcaaggtggtgctggatttgattac
cgacttgcaatggctgtgccggacaaatggattcagatcttaaaagagctgaaggatgaa
gactggaacatgggtaatatagtgcacacattaatcaatagacgatataatgagaaatgt
atcgcctatgcagaaagccatgatcaggcacttgttggagataagacattagcattttgg
ttaatggatgcagagatgtacacaaacatgagtgtattgtcacccttgactccagtgatt
gatcggggaattcagctccataaaatgctgcgtctgatcactcatggtcttggcggtgaa
ggctatctaaatttcataggtaatgagtttgggcatccagaatggttagatttcccaagg
aaaggaaatggagaaagctaccattatgccaggaggcaatttcatttaattgatgatcaa
ctgcttcgctatagatttctttatgcttttgacagagatatgaataatctagaagagaag
tttggatggcttgctgcaccacaggcttatatcagtgcaaagcatgaaggtgataagatc
attgtatttgaaagggcaaatcttcttttcatctttaatttccatccatacaaaagcttt
actggatacagagttgctgtgaacacacctgggaagtatatgatcgctctcgataccgat
gcttctgaatatggcgggcatcaaaggataaaccattcaactgagtttttcacagaggat
gcaccttataacaatcgttcacattcgcttttggtctacattccatgcagggttgctctt
gttcttcgcaatgttaattactcctaa

DBGET integrated database retrieval system