KEGG   Xenopus laevis (African clawed frog): 446435Help
Entry
446435            CDS       T01010                                 

Definition
MGC84594 protein
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     446435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MAPAGRFSGRKIMLSLLLLIICPSCLLSIKVSPLIERTSDHKDFKKLLRTRNNVLVLYSK
SASAAEQQLKLLSNIAQDVKGTATVSWIDCGDGESRKLCKKLKVDPSKKPNGLELLHYKD
GTFHTEYNRPNTYKSLVAFLRDPEGAPLWEENPEAKDVVHIDNEKDFRKLLKKEDRPLLM
MLYAPWCGVCKRLIPSYQQAATNLKGSYVLAGMNIHPPEFDRLKEEYNVKGYPTVLYFEK
GKYMFNFEKYGASANDISDWLKNPQPPTPEAPEVAWADQDNAVYHLTDADFDQFLSEHPS
VLVMFYAPWCGHCKKMKPDYEKAAVTLQQSGVGVLAAVDSTVHRAVSEKFHVTGFPTVKY
FENGEEKYTVPHLRTEQKIVEWMNNPEAPPPPEPSWDEKPSTVLHLVGEEFREALKKKKH
SLVMFYAPWCPHCKSSVPDFTTAADTFKDDRKIAYGAVDCTKEKNQGVCKQEGVEGFPTF
NYYNYGKFSEKYSGERTESGFIGFIKTLRERDQVKLGKKKDEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgccgggcgcttctcgggaaggaagatcatgctctcgctgttgctcttgatc
atctgcccgtcctgccttttatccatcaaggtttctcctcttattgaaagaaccagtgac
cataaagatttcaagaagcttctgcgcacaaggaacaatgttttggttttatactcaaag
tcagcttccgcagcagagcagcagctcaaactcctgtccaacattgctcaggatgttaag
ggaacagcgactgtatcatggatcgactgtggtgatggagagagcagaaagctgtgcaaa
aagttgaaggtggatcccagcaagaagcccaatgggctcgagctgcttcattacaaggat
gggaccttccatacagaatataacagaccaaacacatataagtcacttgtggctttcctg
agagacccagaaggggccccactgtgggaagagaatcctgaagccaaagacgttgtacat
attgataatgagaaggacttccggaagcttctgaagaaggaagatcgcccgctgctaatg
atgctttacgcgccttggtgcggtgtttgcaagcgactgataccatcgtaccagcaagct
gccaccaatctgaagggctcttatgtgcttgcaggaatgaatattcaccccccagagttc
gaccggctgaaggaagagtacaatgtgaagggttacccgaccgtgctttattttgagaag
gggaagtatatgttcaactttgagaagtacggagcctccgctaatgacatctctgactgg
ctgaaaaaccctcagcccccaaccccagaggcccccgaggtggcatgggcggatcaggac
aacgcagtttaccacctgacagatgcagatttcgaccaatttttgtccgaacacccttct
gtgcttgtcatgttctatgctccatggtgcgggcactgtaagaagatgaaacccgactat
gagaaggcggcagtgaccctgcaacaaagtggggttggtgtattggcggcagtagattct
acagtgcacagagccgtgtccgagaaattccacgtcactgggtttcccacagtgaagtat
tttgagaatggtgaggagaaatacacagtacctcatctgcgcacagagcaaaaaatcgtg
gagtggatgaacaacccagaggcgccacccccaccagagccttcctgggatgagaaacct
tccaccgttctgcaccttgtgggggaagagttccgtgaagccctaaagaagaagaaacat
tcactggtcatgttctatgccccttggtgcccacactgtaagagctcggtcccagacttc
acaacagctgctgatacctttaaggatgatagaaagattgcatatggcgctgtagactgc
accaaagagaagaaccagggtgtgtgcaagcaagagggggtggaaggattccctaccttc
aactactacaactacggaaagttctctgagaaatacagtggggaacgaacagaatctgga
tttattggttttataaagacactacgtgagagagaccaggttaaactgggcaagaaaaag
gatgaattgtaa

DBGET integrated database retrieval system