KEGG   Xenopus laevis (African clawed frog): 446478Help
Entry
446478            CDS       T01010                                 

Gene name
pdia6-a, erp5, pdia6, pdip5, txndc7
Definition
protein disulfide isomerase family A, member 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    446478 (pdia6-a)
Enzymes [BR:xla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     446478 (pdia6-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 442 aa AA seqDB search
MARAFLGAVACTLILAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQR
LTPDWKKAATALKGVVKVGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTA
DAIVDAALNSLRSFVKDRLGGRSGGSDSGRQSHSGGSGGSKKDVIELTDDTFDKNVLNSD
DVWLVEFFAPWCGHCKSLEPEWAAAATEVKEKTNGKVKLAAVDATVSQVLASRYGIRGFP
TIKIFQKGEEPVDYDGGRNRADIVARALDLFSENAPPPEINEILNGDIVKKTCDEHQLCI
VAVLPHILDTGAAGRNSYLEVMLKMAEKYKKKMWGWLWTEAGAQMDLETSLGIGGFGYPA
MAAINARKIKFALLKGSFSEQGINEFLRELSYGRGSTSPVGGGAIPKINTVEPWDGKDGE
LPAEDDIDLSDVELDDIGKDEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgagggcgtttcttggtgcagtggcctgcacactgatcttggctgcaagtgccatg
tactcacccagcgacgacgtgattgagttgacacccagcaactttaataaagaagttatc
cagagtgacagtttgtggctggtggagttttatgccccctggtgtgggcactgccagaga
ttgactccagactggaagaaagcagccacagccttaaagggagtggtgaaagttggagct
gtcaatgccgatcagcatcagtcattgggtggtcagtatggggtgcgaggctttccaaca
atcaaagtttttggagccaataagaacaagccagatgattatcaaggagggaggacagcc
gacgccattgtagatgctgcattaaactcacttcgttccttcgttaaggacaggcttggc
ggaaggagcggtggatctgattcaggaagacagagccacagtgggggcagcggtgggagt
aaaaaagacgtcattgagctgacagatgacacatttgataagaatgtactgaacagcgat
gatgtgtggcttgttgaattttttgctccctggtgtgggcattgcaaaagtttagagcct
gaatgggcagctgctgccactgaggttaaggaaaagaccaatggaaaagtaaaattggct
gctgtagatgccactgtcagccaggtgttggccagtcgttatgggataagaggtttcccc
acaattaagatattccagaaaggcgaagagccagtggattatgatggtggaaggaatagg
gctgacattgttgcccgtgcactggatctgttctcagagaatgccccaccccctgagatt
aatgagatcctgaatggagatatagtaaagaagacctgtgatgagcatcagttgtgtatt
gttgctgtgttgccacatattcttgacacaggtgctgctggaagaaattcttacttggaa
gtaatgctgaaaatggcagaaaagtacaaaaagaaaatgtgggggtggttgtggactgag
gctggagctcagatggatctggaaacctcactgggaattggaggctttgggtacccggcc
atggctgccatcaatgcaagaaaaattaaatttgcacttctgaaaggttcctttagtgag
cagggcattaacgagttcttaagggagctttcttatgggcgcggttctacatcacctgtg
ggtggaggagcaattcctaaaatcaatacagtagaaccttgggatggaaaagatggagag
ctgccagcggaggatgatattgatctgagtgatgtggagctggacgacattgggaaagat
gagttgtga

DBGET integrated database retrieval system