KEGG   Xenopus laevis (African clawed frog): 446500Help
Entry
446500            CDS       T01010                                 

Gene name
syk.L, syk
Definition
(RefSeq) spleen tyrosine kinase L homeolog
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    446500 (syk.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     446500 (syk.L)
Protein kinases [BR:xla01001]
 Non-receptor tyrosine kinases
  SYK family
   446500 (syk.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 446500
NCBI-ProteinID: NP_001086665
Xenbase: XB-GENE-978187
UniProt: Q6DE64
Position
1L
AA seq 605 aa AA seqDB search
MADIAQNLPYFFGNITREESEDYLRQAGASDGLYLLRQSRSYLGGYALSVAHGRHFYHYT
IERELNGTYAISGGISHNSPAELCHYHTLESSGLVCLLKKPCNLPPGVQPKTGPFEDLKE
HLIREYVQQTWNLQGEALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISG
VKPNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYS
YKPDGLLRVLTEPCSRATGRKESFIFNRTVCPEPPPHHQMSSAEAMKRNRSSSSMKVLSC
RPNVEVTKDSMPMDTDVYRGIYEDPDEFRPMDGKIAPEQLTLLETELGSGNFGNVKKGML
KTSKSEKPVAVKILKNDSNDESMKDELLKEARVMQLLNNPYIVRMLGICEGASWMLVMEL
AGLGPLNKFLARNKNVTEHNVTELVHQVSMGMKYLEETNFVHRDLAARNVLLVTQHYAKI
SDFGLSKALGTDENYYQAKTTGKWPMKWYAPESLNYHKFSSKSDVWSFGILMWEGYSYGL
KPYPGMKGNEVTVFIESGKRLESPRRCPPEMYNLMKLCWTYSTDERPSFAVVELKLRSYY
YDSSH
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcagatattgcccagaatctgccatatttttttggcaatattacccgtgaagaatca
gaagattacttgaggcaagctggtgcgagtgatggcctgtatttgttgaggcaaagtcgt
agctaccttggtggttatgctctgtcagtggcacatggcaggcatttttaccattatact
attgagagagagttgaatggaacttatgccatttcaggtggcatatctcataacagccct
gctgaactgtgtcattatcacacactagagagcagtggacttgtatgcttgctcaagaaa
ccatgcaatctgccacctggtgttcagccaaaaactggaccatttgaagatcttaaagaa
catctaattagagaatatgtacagcaaacatggaatttacagggtgaagctctggaacaa
gctattatcagtcagaaacctcaactagagaagctaattgccacgactgcacatgaaaaa
atgccatggttccacggaaggatttcacgtgaagattctgagcagttacttatcagtgga
gtaaagccaaatgggtcttttctaataagagaacgagatgataatggatcctatgctctg
tgtttgctgcacgacagaaagatttctcattaccgtattgacagagacaaaactggcaag
ttatcaataccagatgggaaaaaatttgatactctctggcagctggttgaacactattcc
tataaacctgatggacttctgagggtcctgacagagccatgttcccgtgcaactggacgc
aaagaaagctttatatttaaccgtacagtatgtccagaacctcctccccaccaccaaatg
agttctgcagaagccatgaaacggaacagaagttcttcatcaatgaaggttctttcttgt
aggccaaatgtagaagtcacaaaggattctatgcctatggacactgatgtctatagagga
atatatgaagacccagatgagttcagacccatggatggcaaaatagctccggaacagctt
actttgcttgaaactgaacttggatctggcaactttggcaatgttaaaaaaggaatgtta
aagacatcaaaatctgaaaaaccagtagctgttaagattcttaaaaatgacagcaatgat
gagtcaatgaaggacgagctcctcaaagaagccagagtcatgcagctattgaataatccc
tacattgtcagaatgcttggaatctgtgaaggggcatcatggatgcttgtcatggagctg
gcaggacttgggcctctaaataagttcttggctagaaacaaaaatgttacagaacataat
gtaacagagcttgtacatcaggtctccatgggaatgaagtatttagaagaaacaaatttt
gtccacagagatctggccgcacgaaatgttttgctggtcacacaacattatgccaaaatc
agtgatttcgggctttccaaagcacttggaactgatgaaaattattaccaagcaaagact
actggaaagtggcctatgaaatggtatgcccctgaatctttaaactatcataaattctca
agcaagagtgatgtatggagctttggaattctaatgtgggaggggtattcctacggtcta
aagccatatccaggaatgaaaggtaatgaagtgacagtttttattgaatcaggaaaacgc
ttggagtcccctcgacgttgtccaccagaaatgtacaatttaatgaaattatgttggaca
tatagcacggatgaacgaccttcttttgctgtagttgaactgaaactccggagttattat
tatgatagttctcactga

DBGET integrated database retrieval system