KEGG   Xenopus laevis (African clawed frog): 446500Help
Entry
446500            CDS       T01010                                 

Gene name
syk
Definition
spleen tyrosine kinase (EC:2.7.10.1)
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     446500 (syk)
Protein kinases [BR:xla01001]
 Tyrosine protein kinases
  Syk family
   446500 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 605 aa AA seqDB search
MADIAQNLPYFFGNITREESEDYLRQAGASDGLYLLRQSRSYLGGYALSVAHGRHFYHYT
IERELNGTYAISGGISHNSPAELCHYHTLESSGLVCLLKKPCNLPPGVQPKTGPFEDLKE
HLIREYVQQTWNLQGEALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISG
VKPNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYS
YKPDGLLRVLTEPCSRATGRKESFIFNRTVCPEPPPHHQMSSAEAMKRNRSSSSMKVLSC
RPNVEVTKDSMPMDTDVYRGIYEDPDEFRPMDGKIAPEQLTLLETELGSGNFGNVKKGML
KTSKSEKPVAVKILKNDSNDESMKDELLKEARVMQLLNNPYIVRMLGICEGASWMLVMEL
AGLGPLNKFLARNKNVTEHNVTELVHQVSMGMKYLEETNFVHRDLAARNVLLVTQHYAKI
SDFGLSKALGTDENYYQAKTTGKWPMKWYAPESLNYHKFSSKSDVWSFGILMWEGYSYGL
KPYPGMKGNEVTVFIESGKRLESPRRCPPEMYNLMKLCWTYSTDERPSFAVVELKLRSYY
YDSSH
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcagatattgcccagaatctgccatatttttttggcaatattacccgtgaagaatca
gaagattacttgaggcaagctggtgcgagtgatggcctgtatttgttgaggcaaagtcgt
agctaccttggtggttatgctctgtcagtggcacatggcaggcatttttaccattatact
attgagagagagttgaatggaacttatgccatttcaggtggcatatctcataacagccct
gctgaactgtgtcattatcacacactagagagcagtggacttgtatgcttgctcaagaaa
ccatgcaatctgccacctggtgttcagccaaaaactggaccatttgaagatcttaaagaa
catctaattagagaatatgtacagcaaacatggaatttacagggtgaagctctggaacaa
gctattatcagtcagaaacctcaactagagaagctaattgccacgactgcacatgaaaaa
atgccatggttccacggaaggatttcacgtgaagattctgagcagttacttatcagtgga
gtaaagccaaatgggtcttttctaataagagaacgagatgataatggatcctatgctctg
tgtttgctgcacgacagaaagatttctcattaccgtattgacagagacaaaactggcaag
ttatcaataccagatgggaaaaaatttgatactctctggcagctggttgaacactattcc
tataaacctgatggacttctgagggtcctgacagagccatgttcccgtgcaactggacgc
aaagaaagctttatatttaaccgtacagtatgtccagaacctcctccccaccaccaaatg
agttctgcagaagccatgaaacggaacagaagttcttcatcaatgaaggttctttcttgt
aggccaaatgtagaagtcacaaaggattctatgcctatggacactgatgtctatagagga
atatatgaagacccagatgagttcagacccatggatggcaaaatagctccggaacagctt
actttgcttgaaactgaacttggatctggcaactttggcaatgttaaaaaaggaatgtta
aagacatcaaaatctgaaaaaccagtagctgttaagattcttaaaaatgacagcaatgat
gagtcaatgaaggacgagctcctcaaagaagccagagtcatgcagctattgaataatccc
tacattgtcagaatgcttggaatctgtgaaggggcatcatggatgcttgtcatggagctg
gcaggacttgggcctctaaataagttcttggctagaaacaaaaatgttacagaacataat
gtaacagagcttgtacatcaggtctccatgggaatgaagtatttagaagaaacaaatttt
gtccacagagatctggccgcacgaaatgttttgctggtcacacaacattatgccaaaatc
agtgatttcgggctttccaaagcacttggaactgatgaaaattattaccaagcaaagact
actggaaagtggcctatgaaatggtatgcccctgaatctttaaactatcataaattctca
agcaagagtgatgtatggagctttggaattctaatgtgggaggggtattcctacggtcta
aagccatatccaggaatgaaaggtaatgaagtgacagtttttattgaatcaggaaaacgc
ttggagtcccctcgacgttgtccaccagaaatgtacaatttaatgaaattatgttggaca
tatagcacggatgaacgaccttcttttgctgtagttgaactgaaactccggagttattat
tatgatagttctcactga

DBGET integrated database retrieval system