KEGG   Xenopus laevis (African clawed frog): 446574Help
Entry
446574            CDS       T01010                                 

Gene name
anapc7
Definition
anaphase promoting complex subunit 7
Orthology
K03354  
anaphase-promoting complex subunit 7
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    446574 (anapc7)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    446574 (anapc7)
   04114 Oocyte meiosis
    446574 (anapc7)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    446574 (anapc7)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     446574 (anapc7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 565 aa AA seqDB search
MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPEMFSPSQKYQLLVYHADSLFHDKEYR
NAVSKYTMALQQKKALTKTSKVRPATGNAAATPQNQCLPSEIEVKYKMADCYTMLKQDKD
AIAILDGIPSRQRTPKINMMLANLYKKAGQERSAVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTLNVIQSIPNLDWLSAWIKAYAFVHTGDNTRAINTICSLEKKSLLRDNVDLL
GTLADLYFRVGDNKNAILKFEQAQMLDPYLIKGMDIYGYLLAREGRLEDVENLGCRLFNI
SDQHAEPWVVSGCHSFYTKRHSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCCEGLIECYLASSSVREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALIQRPDYIKAVVKKAELLSREQKYDEGIALLRNTLANQSDCVLHRM
LGDFLVVVNEFQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSG
EEGDLEGSDSEAAQWADQEPWFAMQ
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaatagatcatgtacgggacatggcagcggccgggctgcactctaatgtgcga
ttactgagcagtctcctactgactatgagcaacaacaacccggagatgttttctccatca
caaaagtaccagttgcttgtgtaccacgcggactctctgttccatgacaaggaatacaga
aatgctgtcagcaagtacacaatggctctgcagcagaagaaagctttaaccaagacttcc
aaagttagaccagccacaggaaatgcagcggccaccccacaaaatcagtgtcttccatca
gagattgaggtgaaatataaaatggctgactgttacaccatgctgaaacaggacaaggat
gccattgccattttagatggaattccttctcggcagagaaccccaaagattaacatgatg
ttagctaatttgtacaagaaagctggacaggagcgttctgcagtaaccagttacaaggag
gttctgagacagtgcccactggcacttgatgccatactaggattgctctctctctctgta
aaaggagcagaagttgcgtctatgactctcaatgtcatccagagtattcccaatctagac
tggctttctgcctggatcaaagcctatgcatttgtgcacactggagacaacaccagagct
atcaacactatctgttctctagaaaagaaatctttactaagggacaatgtagatctcctg
gggactttggcagatttgtatttccgtgttggcgacaataaaaatgccattcttaagttt
gagcaagctcagatgctggatccttatctcataaaaggaatggatatatatggctacttg
ctggctcgtgaaggtcgactagaagatgtggagaatctcggctgccgcttgttcaatata
tctgatcagcatgctgagccgtgggtggtttctgggtgccacagcttttataccaagaga
cattccagagccctgtatttgggagccaaggctatccagctgaacagcaatagtgttcag
gccttactacttaagggggcagcattaagaaacatgggaagggtgcaggaagcaatcatt
catttccgagaagcaattcgactggcaccttgtcggctcgactgctgtgaaggtctcatt
gagtgctatttggcatccagcagcgtacgtgaagctatggtgatggccaacaatgtctat
aaaacccttggagcaaatgcacaaactctaactcttttggcaactgtgtgcctggaagat
cctgttacccaagagaaagcaaaaacattgttagacaaagcgctcattcaaagaccggat
tatataaaggctgtggtgaagaaagcagagttactcagtcgagagcagaagtatgatgaa
ggaattgccctgcttcgtaatacccttgcaaaccagagtgactgtgtattacatcggatg
ttaggagattttcttgtggtggttaatgagtttcaggaagctatggatcagtacagcatt
gcactcagtttggatccgaatgaccaaaaatccttggagggaatgcagaaaatggagaag
gaagagagccctacagatgccacacaggaagaagatgtggatgatatggaggggagtggg
gaagagggagacctagagggcagtgacagtgaagctgctcagtgggcagatcaggagccg
tggtttgcaatgcagtga

DBGET integrated database retrieval system