KEGG   Xenopus laevis (African clawed frog): 446581Help
Entry
446581            CDS       T01010                                 

Gene name
usp25
Definition
ubiquitin specific peptidase 25 (EC:3.1.2.15)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     446581 (usp25)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   446581 (usp25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1046 aa AA seqDB search
MTVEQNVLQQNSQKHQQTFLNQLREITGINDLQVLQQALKDSNGNLELAVAFLTAKNAKL
PQPEEATYYQTALPNNDRYISVGSQADTNVIDLTVDDKDDLQRAIALSLEESNRTFRETG
ITDEEQAISRVLEASIAENKACLKRTHTEVWSDSPNPYDRKRQENCPVGLKNVGNTCWFS
AVIQSLFNLLEFRRLVLNYNPPSSAQDVPRNQKEHRNLPFMRELRYLFSLMVSSKRKYVD
PSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQIKAEEERDGEKPKNPMVELFYG
RFLAVGVHEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQEH
WFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPPCLYMDRYMHKNREITRLKRDEIKR
LKDHLTVLQQRLERYLSYGSGPKRFPLADVLQYALEFASSKPVCTSPVEDIDVSAPPSGC
VATQTVQSTTEHQGSSSASETQLPTQRSVIHKPFTQSRIPPDLPMHPAPRNITDEELSVL
EGCLHRWRTEVETDTRDLQDSIGRIHRTIELMYSDKQMNQVPYKLHAVLVHEGQANAGHY
WAYIFDHHEQRWMKYNDISVTKSSWEELERDSFGGYRNASAYCLMYINDEEKCLMQEEYD
KETGQVLKGMDILPLDLREYIKEDNRRFEKELEAWDKEQLRKAEQEKMILAQKALKQAPL
VVAAPPNEPEYMEQPARADAPNETSEETTNVITQAATESEDKGPEAVLQMAIKTEYARLV
KLAQEDPLPEIDYRLQHAIIYFIQSQPPKKIIERTLLEQFADRNLSFDERCRNIMKVAQA
KLEMIKPDEVNMEEYRKWHKDYRMFRETTMYILIGLELFQNKSYVEALLYLIYGYQYNKE
LLSKGLYRGHDEQLISHYRRECFLKLNEQAAAMFESGDMDEVNNGLASMNELIVPCLPLL
LVDDMEEKDIVAVEDMRNRWCSYLGQEMEPNLQEKLTDFLPKLLDCSTEIKGLNDPPKLP
NFSTHELCERFARIMLSLSRMPADGR
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcaaaatgtcctgcagcagaactcccagaagcaccagcagacctttttg
aatcagctgagggagatcacgggcatcaatgaccttcaagtactccaacaagctcttaag
gatagcaatgggaatctggagctagctgttgcctttctgactgcaaagaatgccaagctt
ccccagccagaagaggcgacgtattatcagactgcactgcctaacaatgaccgatacatc
agtgtgggcagccaagcagacacaaatgtcattgatctgacagtagatgataaagatgac
cttcagagggccattgctctaagcttggaggagtccaacaggacattcagggagaccgga
atcactgatgaggagcaagccattagcagggtgttagaagccagcattgcagagaacaaa
gcatgtcttaaacggacacacaccgaggtctggagtgactctcccaatccttatgatcgc
aaacgccaagaaaactgccctgtcggattaaagaatgtaggcaatacgtgctggttcagt
gctgtcattcagtcgttatttaacctgctggaattccgcagactggttctgaactacaac
cccccttcaagtgctcaggatgtcccacgaaaccaaaaggaacataggaatttgcctttc
atgcgtgagctgagatacctgttttcactcatggtcagctccaaaagaaagtatgtcgat
ccatccagagctgttgaaattcttaaggatgctttcaaatccaatgactctcagcagcaa
gatgtcagtgaattcactcacaaactcttggactggttggaagatgctttccagataaaa
gcagaagaggaaagagatggagaaaagccaaagaacccgatggtggaattattttacgga
aggttcctggcagtgggtgtacatgaaggtaagaaatttgagaacacggaaatgttcggc
cagtacccactgcaggtgaatggcttcaaggacctgcacgagtgcctagaggctgccatg
attgaaggggagatagaatcgttgcactcagaaaactcgggcaagtcaggccaagagcat
tggttcacagagctcccacctgtgttaaccttcgaactttcaagatttgaattcaaccaa
gcactgggaaggccggagaaaatacacaacaaactagaattcccaccatgtttgtatatg
gacaggtacatgcacaagaacagggaaatcacaaggctcaaacgagatgaaatcaaaaga
ctgaaagatcacctcacagtgttacagcaaaggctagaacggtatttgagttacggttct
ggccccaaacggttccctctggcagatgtcttacagtatgccctggaatttgcatcaagc
aagcctgtttgcacttccccagttgaagatattgatgtgagtgcgccacctagtggctgt
gtggcaacgcaaaccgtgcaaagcacaacagagcatcaggggtcttcctcagcctctgaa
acacagcttcccacccaacgatctgtaatccacaaacctttcacacagtcccgaatacct
ccagatctacctatgcaccccgcaccccgcaacattacagatgaggaactctccgtatta
gagggctgtttgcatcgctggagaactgaagtggaaaccgatacaagagatctgcaggac
agcataggaagaatacaccggacaatagagctcatgtactctgataagcagatgaaccag
gttccatacaagctgcacgccgtacttgtccacgaaggccaagctaacgcaggtcactac
tgggcttacatatttgaccaccatgagcaacgatggatgaaatacaacgacatttctgtc
accaagtcttcgtgggaagagctcgagcgagattcttttggcgggtacaggaacgcaagt
gcctactgtctgatgtatatcaatgacgaggaaaagtgtttaatgcaagaggagtacgac
aaggagacggggcaggttcttaaaggtatggacatcctgccattagatttaagggaatac
atcaaggaagacaaccggcggtttgagaaggaacttgaagcgtgggacaaagagcagctc
cggaaagctgaacaggagaagatgattttagcccaaaaggccttgaaacaggctccattg
gttgtagcagctccaccaaacgagccggaatatatggaacaaccagcaagagcagacgcc
cctaatgagacgagcgaagaaaccactaatgtcatcactcaagcagctacagaatcagaa
gataaagggcctgaggctgtgttgcaaatggccatcaaaacagaatacgcacgactagtg
aaactagcgcaagaagatcccctgcccgagatagattaccgcttgcagcacgccatcatc
tacttcatccaaagccaaccaccaaagaaaatcatagagaggacgttgctggagcagttt
gccgaccgtaatttgagttttgatgaacgatgccgcaatattatgaaagttgctcaggct
aaacttgaaatgataaaaccagatgaggtcaacatggaggaatacaggaagtggcacaag
gactatagaatgttcagagagacaacaatgtacatcttgattggccttgagctgtttcag
aacaagagctatgttgaagcactgctgtacctaatttacggctaccagtacaataaagag
ctgctctccaaaggcctctacagaggacacgatgaacaactgatatcccattacagaagg
gagtgctttctgaaactgaacgagcaggcagcagccatgtttgaatctggagacatggat
gaagtgaacaatggcctggcatccatgaatgagctcatcgtcccgtgtctgcccttgctg
ctagttgatgacatggaagagaaggacattgtagccgtggaagacatgagaaaccgttgg
tgttcctacctgggccaagaaatggagccaaatctgcaagaaaagctgaccgacttcctg
ccaaaactgcttgattgttcgacagaaatcaaaggtctaaacgacccgccaaagcttccc
aatttctccacacacgaactgtgcgagcgctttgcccgaatcatgttgtcacttagccga
atgcctgcagacgggagataa

DBGET integrated database retrieval system