KEGG   Xenopus laevis (African clawed frog): 446588Help
Entry
446588            CDS       T01010                                 

Gene name
hist1h2bj, h2B, h2bfr
Definition
histone cluster 1, H2bj
Orthology
K11252  
histone H2B
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   446588 (hist1h2bj)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAM
SIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcccgccaaatccgctccagccccaaagaagggctccaaaaaagccgtcact
aaaacccagaagaaggatggcaagaagcgtaggaagagcaggaaagagagctacgccatc
tacgtgtacaaagtgctcaagcaggtgcaccccgataccggcatctcttccaaggccatg
agcatcatgaactcctttgttaacgatgtcttcgagcgcatcgcaggggaagcctcccgc
ctggctcactacaacaagcgctccaccatcacctcccgggagatccagaccgcggtccgc
ctgctcttgcctggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagcgccaagtaa

DBGET integrated database retrieval system