KEGG   Xenopus laevis (African clawed frog): 446599Help
Entry
446599            CDS       T01010                                 

Gene name
mapk7.L, bmk1, erk4, mapk7, prkm7
Definition
(RefSeq) mitogen-activated protein kinase 7 L homeolog
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    446599 (mapk7.L)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    446599 (mapk7.L)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    446599 (mapk7.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     446599 (mapk7.L)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   446599 (mapk7.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
5L
AA seq 925 aa AA seqDB search
MAEPRKEQEEVQDGVGTKLDAGRSTSRPNMGLAILQERSFDINFEVGDEYEIIETIGVGA
YGVVSSARRKGSGQRVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNVIAIKDILKPSV
PYNDFRSVYVVLDLMESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKP
SNLLINENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAIDM
WSVGCIFAEMLGRKPLFPGNNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQ
PVPWATLYPQAGKKALDLLSKMLRFDTRDRISVAEALRHPFLSKYHDPDDEPECIPAFDF
GFDKNILTKDQIKEAITTEIDSFHRRREGIRRQISFKPALRPAVEGPREDGPIQEDAFKS
PPLPPAVQGLDIDMPSANSAREKADFPMESPRVPENTETIDLTSPVEDEEAVVQGDDNKA
REETPVVKAEPEPLPKREGAISEDTKAALKAALLKSALRNKSKDAPCSVPEVPDIRKPVT
AQERQREREEKRRRRQERAREREKKQKEKERREVKKMEGFGGLVLSENDKNLLDRWSRMV
DQTQQPVVPPAPITGPSHAPCTNQAVNICTVAQPLQPSVFGVANLAPLIEVGSQQNGTLA
APTVPPTIQFIPRCLNPCAVTNLLHYVPPSSASFQISSVMLTTQAKQDSSSISAQLPTDV
SFISRPIVTNRFTTPARINPPWPRSVAQEGWSGTNTVDCKSVDPSLFLHKPADQPQGVPG
LAYSNGANGHNPEQHKPQSFQPLPPTSCSTANTSQTTSPDINLVTQQLSKSQVEDILPPV
FSVTPKGSGAGYGVGFDLEEFLNQSFDMAAENRESQVDSAPLSASLLADWLDIHSMNPVD
MASLQEDLQLGSPMSLSDIPDLQDT
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccaaggaaggagcaagaggaagtgcaagatggagtgggcaccaaactggac
gcaggtcgcagcacttccaggccaaacatgggccttgcaatcctccaagagcgctccttc
gatatcaactttgaagttggggacgagtacgagatcatcgaaaccatcggtgtcggcgct
tacggtgtggtgtcgtccgccaggcggaaaggctccggtcaaagggtcgccattaagaaa
atccccaacgcctttgatgtggttaccaacgcgaaacgcaccctgagagaacttaaaata
ctgaagcacttcaaacatgacaatgttattgccattaaggacatcttaaaaccatctgtg
ccttacaacgacttcagatctgtatatgtggtactggatctcatggagagtgatttgcac
caaatcatccactcctcacagccactaacccttgagcacgcccgctatttcctctatcag
ctactgcgtggcttgaaatacatccactcggccaatgttttgcaccgggatctgaagccc
agcaaccttcttattaatgagaactgtgagctgaagattggagactttggaatggctcgt
ggtctctgcaccaagcctgatgagtacaagtatttcatgacagagtatgtggccactcgg
tggtatcgggctcctgaacttatgttgtctctccatgagtacacgcaggccattgacatg
tggtctgtggggtgcatatttgctgaaatgttgggacgtaaacctctttttcctggcaac
aactaccttcaccagctgcatctcatcatgactgtactgggcacaccctccagtcaggtg
atccgagctattggggcagagagagtaagggcatatatccagagtcttccttcgcgccag
ccagtgccttgggcaactctttacccccaagctggcaagaaggctctggatctgctttca
aaaatgctacgttttgacacacgcgaccgtatttctgtggcagaagcactcaggcacccg
ttcctgtccaaatatcatgaccctgacgatgaaccagaatgtatcccggcctttgacttt
ggctttgataaaaatattcttacaaaggaccaaataaaagaggctatcaccacagagatt
gacagctttcaccgtagaagggagggcatacgacggcagataagctttaagccagcactg
agaccagctgtggaagggcctagggaggatggacctattcaagaagatgctttcaaatca
ccacctctacccccggctgttcagggattggatatagacatgccaagtgccaattcggct
cgggagaaggctgattttcccatggagtctccccgagttccagagaacacagagaccatt
gatctcacctcccccgtggaggatgaagaggcagtggtacagggtgatgataacaaagcc
agagaagaaacaccagtggtcaaagctgagccggagcctttgccaaagcgagagggagct
atatccgaggatactaaagcagcgctaaaggctgctctcttgaagtctgccttacggaac
aagagcaaagatgcgccctgttctgttcctgaggtgcctgacatacggaaaccagtcaca
gctcaggagcgccagcgggagagggaggagaaacggaggaggcgccaggaacgtgccagg
gagagggaaaagaagcagaaagagaaggagcggcgggaagtgaagaaaatggaaggcttt
ggaggtctagtgctgagcgagaacgataagaatttgttggaccgttggagtagaatggtt
gaccagacccagcagcctgttgttcctcctgctccgataacagggcccagtcatgccccc
tgcaccaatcaagctgttaatatttgcactgtggctcagccgctgcagccgtccgtgttt
ggtgtggcaaacttagctcctcttatagaggttgggagtcaacagaacggtactcttgct
gccccaacggtacctcctaccatccagtttattcctaggtgtctgaacccttgcgcagtg
accaacctgctccattatgtacctccctcctctgcaagctttcagattagttccgttatg
ctgaccacccaagcaaagcaggactccagttcgatatctgcccagctgcccaccgatgtc
tcattcattagcagaccaatcgtgaccaatcgttttaccactcccgcaagaatcaatcca
ccttggccccggtctgtagctcaggagggctggtccgggacgaatactgttgattgcaag
agtgtggatccttccctctttctccacaagcctgctgaccagccgcagggagttcctgga
cttgcatattcaaatggagccaacggccacaatccagaacagcacaaacctcaaagtttc
caacctcttccgcctacgtcctgtagcaccgccaacacctcacagacaacctctccagac
atcaacttggtgactcagcagctttctaaatcccaggttgaagacattctccctccagtt
ttttcggtcaccccaaaaggaagtggagctggctacggagtaggctttgatctggaagaa
tttcttaatcagtcctttgatatggcagcagagaaccgtgaaagccaagtggactccgcc
ccgctttctgcttccctactggccgactggctcgacattcacagcatgaacccggtagac
atggcctccctgcaggaggatctgcagctcggctctccgatgagtctctccgacatccct
gacctgcaggatacctaa

DBGET integrated database retrieval system