KEGG   Xenopus laevis (African clawed frog): 446599Help
Entry
446599            CDS       T01010                                 

Gene name
mapk7, bmk1, erk4, prkm7
Definition
mitogen-activated protein kinase 7
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Cellular Processes; Cell communication; Gap junction [PATH:xla04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xla04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 925 aa AA seqDB search
MAEPRKEQEEVQDGVGTKLDAGRSTSRPNMGLAILQERSFDINFEVGDEYEIIETIGVGA
YGVVSSARRKGSGQRVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNVIAIKDILKPSV
PYNDFRSVYVVLDLMESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKP
SNLLINENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAIDM
WSVGCIFAEMLGRKPLFPGNNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQ
PVPWATLYPQAGKKALDLLSKMLRFDTRDRISVAEALRHPFLSKYHDPDDEPECIPAFDF
GFDKNILTKDQIKEAITTEIDSFHRRREGIRRQISFKPALRPAVEGPREDGPIQEDAFKS
PPLPPAVQGLDIDMPSANSAREKADFPMESPRVPENTETIDLTSPVEDEEAVVQGDDNKA
REETPVVKAEPEPLPKREGAISEDTKAALKAALLKSALRNKSKDAPCSVPEVPDIRKPVT
AQERQREREEKRRRRQERAREREKKQKEKERREVKKMEGFGGLVLSENDKNLLDRWSRMV
DQTQQPVVPPAPITGPSHAPCTNQAVNICTVAQPLQPSVFGVANLAPLIEVGSQQNGTLA
APTVPPTIQFIPRCLNPCAVTNLLHYVPPSSASFQISSVMLTTQAKQDSSSISAQLPTDV
SFISRPIVTNRFTTPARINPPWPRSVAQEGWSGTNTVDCKSVDPSLFLHKPADQPQGVPG
LAYSNGANGHNPEQHKPQSFQPLPPTSCSTANTSQTTSPDINLVTQQLSKSQVEDILPPV
FSVTPKGSGAGYGVGFDLEEFLNQSFDMAAENRESQVDSAPLSASLLADWLDIHSMNPVD
MASLQEDLQLGSPMSLSDIPDLQDT
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccaaggaaggagcaagaggaagtgcaagatggagtgggcaccaaactggac
gcaggtcgcagcacttccaggccaaacatgggccttgcaatcctccaagagcgctccttc
gatatcaactttgaagttggggacgagtacgagatcatcgaaaccatcggtgtcggcgct
tacggtgtggtgtcgtccgccaggcggaaaggctccggtcaaagggtcgccattaagaaa
atccccaacgcctttgatgtggttaccaacgcgaaacgcaccctgagagaacttaaaata
ctgaagcacttcaaacatgacaatgttattgccattaaggacatcttaaaaccatctgtg
ccttacaacgacttcagatctgtatatgtggtactggatctcatggagagtgatttgcac
caaatcatccactcctcacagccactaacccttgagcacgcccgctatttcctctatcag
ctactgcgtggcttgaaatacatccactcggccaatgttttgcaccgggatctgaagccc
agcaaccttcttattaatgagaactgtgagctgaagattggagactttggaatggctcgt
ggtctctgcaccaagcctgatgagtacaagtatttcatgacagagtatgtggccactcgg
tggtatcgggctcctgaacttatgttgtctctccatgagtacacgcaggccattgacatg
tggtctgtggggtgcatatttgctgaaatgttgggacgtaaacctctttttcctggcaac
aactaccttcaccagctgcatctcatcatgactgtactgggcacaccctccagtcaggtg
atccgagctattggggcagagagagtaagggcatatatccagagtcttccttcgcgccag
ccagtgccttgggcaactctttacccccaagctggcaagaaggctctggatctgctttca
aaaatgctacgttttgacacacgcgaccgtatttctgtggcagaagcactcaggcacccg
ttcctgtccaaatatcatgaccctgacgatgaaccagaatgtatcccggcctttgacttt
ggctttgataaaaatattcttacaaaggaccaaataaaagaggctatcaccacagagatt
gacagctttcaccgtagaagggagggcatacgacggcagataagctttaagccagcactg
agaccagctgtggaagggcctagggaggatggacctattcaagaagatgctttcaaatca
ccacctctacccccggctgttcagggattggatatagacatgccaagtgccaattcggct
cgggagaaggctgattttcccatggagtctccccgagttccagagaacacagagaccatt
gatctcacctcccccgtggaggatgaagaggcagtggtacagggtgatgataacaaagcc
agagaagaaacaccagtggtcaaagctgagccggagcctttgccaaagcgagagggagct
atatccgaggatactaaagcagcgctaaaggctgctctcttgaagtctgccttacggaac
aagagcaaagatgcgccctgttctgttcctgaggtgcctgacatacggaaaccagtcaca
gctcaggagcgccagcgggagagggaggagaaacggaggaggcgccaggaacgtgccagg
gagagggaaaagaagcagaaagagaaggagcggcgggaagtgaagaaaatggaaggcttt
ggaggtctagtgctgagcgagaacgataagaatttgttggaccgttggagtagaatggtt
gaccagacccagcagcctgttgttcctcctgctccgataacagggcccagtcatgccccc
tgcaccaatcaagctgttaatatttgcactgtggctcagccgctgcagccgtccgtgttt
ggtgtggcaaacttagctcctcttatagaggttgggagtcaacagaacggtactcttgct
gccccaacggtacctcctaccatccagtttattcctaggtgtctgaacccttgcgcagtg
accaacctgctccattatgtacctccctcctctgcaagctttcagattagttccgttatg
ctgaccacccaagcaaagcaggactccagttcgatatctgcccagctgcccaccgatgtc
tcattcattagcagaccaatcgtgaccaatcgttttaccactcccgcaagaatcaatcca
ccttggccccggtctgtagctcaggagggctggtccgggacgaatactgttgattgcaag
agtgtggatccttccctctttctccacaagcctgctgaccagccgcagggagttcctgga
cttgcatattcaaatggagccaacggccacaatccagaacagcacaaacctcaaagtttc
caacctcttccgcctacgtcctgtagcaccgccaacacctcacagacaacctctccagac
atcaacttggtgactcagcagctttctaaatcccaggttgaagacattctccctccagtt
ttttcggtcaccccaaaaggaagtggagctggctacggagtaggctttgatctggaagaa
tttcttaatcagtcctttgatatggcagcagagaaccgtgaaagccaagtggactccgcc
ccgctttctgcttccctactggccgactggctcgacattcacagcatgaacccggtagac
atggcctccctgcaggaggatctgcagctcggctctccgatgagtctctccgacatccct
gacctgcaggatacctaa

DBGET integrated database retrieval system