KEGG   Xenopus laevis (African clawed frog): 446599Help
Entry
446599            CDS       T01010                                 

Gene name
mapk7, bmk1, erk4, prkm7
Definition
mitogen-activated protein kinase 7
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    446599 (mapk7)
 Cellular Processes
  Cell communication
   04540 Gap junction
    446599 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    446599 (mapk7)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     446599 (mapk7)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   446599 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 925 aa AA seqDB search
MAEPRKEQEEVQDGVGTKLDAGRSTSRPNMGLAILQERSFDINFEVGDEYEIIETIGVGA
YGVVSSARRKGSGQRVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNVIAIKDILKPSV
PYNDFRSVYVVLDLMESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKP
SNLLINENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAIDM
WSVGCIFAEMLGRKPLFPGNNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQ
PVPWATLYPQAGKKALDLLSKMLRFDTRDRISVAEALRHPFLSKYHDPDDEPECIPAFDF
GFDKNILTKDQIKEAITTEIDSFHRRREGIRRQISFKPALRPAVEGPREDGPIQEDAFKS
PPLPPAVQGLDIDMPSANSAREKADFPMESPRVPENTETIDLTSPVEDEEAVVQGDDNKA
REETPVVKAEPEPLPKREGAISEDTKAALKAALLKSALRNKSKDAPCSVPEVPDIRKPVT
AQERQREREEKRRRRQERAREREKKQKEKERREVKKMEGFGGLVLSENDKNLLDRWSRMV
DQTQQPVVPPAPITGPSHAPCTNQAVNICTVAQPLQPSVFGVANLAPLIEVGSQQNGTLA
APTVPPTIQFIPRCLNPCAVTNLLHYVPPSSASFQISSVMLTTQAKQDSSSISAQLPTDV
SFISRPIVTNRFTTPARINPPWPRSVAQEGWSGTNTVDCKSVDPSLFLHKPADQPQGVPG
LAYSNGANGHNPEQHKPQSFQPLPPTSCSTANTSQTTSPDINLVTQQLSKSQVEDILPPV
FSVTPKGSGAGYGVGFDLEEFLNQSFDMAAENRESQVDSAPLSASLLADWLDIHSMNPVD
MASLQEDLQLGSPMSLSDIPDLQDT
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccaaggaaggagcaagaggaagtgcaagatggagtgggcaccaaactggac
gcaggtcgcagcacttccaggccaaacatgggccttgcaatcctccaagagcgctccttc
gatatcaactttgaagttggggacgagtacgagatcatcgaaaccatcggtgtcggcgct
tacggtgtggtgtcgtccgccaggcggaaaggctccggtcaaagggtcgccattaagaaa
atccccaacgcctttgatgtggttaccaacgcgaaacgcaccctgagagaacttaaaata
ctgaagcacttcaaacatgacaatgttattgccattaaggacatcttaaaaccatctgtg
ccttacaacgacttcagatctgtatatgtggtactggatctcatggagagtgatttgcac
caaatcatccactcctcacagccactaacccttgagcacgcccgctatttcctctatcag
ctactgcgtggcttgaaatacatccactcggccaatgttttgcaccgggatctgaagccc
agcaaccttcttattaatgagaactgtgagctgaagattggagactttggaatggctcgt
ggtctctgcaccaagcctgatgagtacaagtatttcatgacagagtatgtggccactcgg
tggtatcgggctcctgaacttatgttgtctctccatgagtacacgcaggccattgacatg
tggtctgtggggtgcatatttgctgaaatgttgggacgtaaacctctttttcctggcaac
aactaccttcaccagctgcatctcatcatgactgtactgggcacaccctccagtcaggtg
atccgagctattggggcagagagagtaagggcatatatccagagtcttccttcgcgccag
ccagtgccttgggcaactctttacccccaagctggcaagaaggctctggatctgctttca
aaaatgctacgttttgacacacgcgaccgtatttctgtggcagaagcactcaggcacccg
ttcctgtccaaatatcatgaccctgacgatgaaccagaatgtatcccggcctttgacttt
ggctttgataaaaatattcttacaaaggaccaaataaaagaggctatcaccacagagatt
gacagctttcaccgtagaagggagggcatacgacggcagataagctttaagccagcactg
agaccagctgtggaagggcctagggaggatggacctattcaagaagatgctttcaaatca
ccacctctacccccggctgttcagggattggatatagacatgccaagtgccaattcggct
cgggagaaggctgattttcccatggagtctccccgagttccagagaacacagagaccatt
gatctcacctcccccgtggaggatgaagaggcagtggtacagggtgatgataacaaagcc
agagaagaaacaccagtggtcaaagctgagccggagcctttgccaaagcgagagggagct
atatccgaggatactaaagcagcgctaaaggctgctctcttgaagtctgccttacggaac
aagagcaaagatgcgccctgttctgttcctgaggtgcctgacatacggaaaccagtcaca
gctcaggagcgccagcgggagagggaggagaaacggaggaggcgccaggaacgtgccagg
gagagggaaaagaagcagaaagagaaggagcggcgggaagtgaagaaaatggaaggcttt
ggaggtctagtgctgagcgagaacgataagaatttgttggaccgttggagtagaatggtt
gaccagacccagcagcctgttgttcctcctgctccgataacagggcccagtcatgccccc
tgcaccaatcaagctgttaatatttgcactgtggctcagccgctgcagccgtccgtgttt
ggtgtggcaaacttagctcctcttatagaggttgggagtcaacagaacggtactcttgct
gccccaacggtacctcctaccatccagtttattcctaggtgtctgaacccttgcgcagtg
accaacctgctccattatgtacctccctcctctgcaagctttcagattagttccgttatg
ctgaccacccaagcaaagcaggactccagttcgatatctgcccagctgcccaccgatgtc
tcattcattagcagaccaatcgtgaccaatcgttttaccactcccgcaagaatcaatcca
ccttggccccggtctgtagctcaggagggctggtccgggacgaatactgttgattgcaag
agtgtggatccttccctctttctccacaagcctgctgaccagccgcagggagttcctgga
cttgcatattcaaatggagccaacggccacaatccagaacagcacaaacctcaaagtttc
caacctcttccgcctacgtcctgtagcaccgccaacacctcacagacaacctctccagac
atcaacttggtgactcagcagctttctaaatcccaggttgaagacattctccctccagtt
ttttcggtcaccccaaaaggaagtggagctggctacggagtaggctttgatctggaagaa
tttcttaatcagtcctttgatatggcagcagagaaccgtgaaagccaagtggactccgcc
ccgctttctgcttccctactggccgactggctcgacattcacagcatgaacccggtagac
atggcctccctgcaggaggatctgcagctcggctctccgatgagtctctccgacatccct
gacctgcaggatacctaa

DBGET integrated database retrieval system