KEGG   Xenopus laevis (African clawed frog): 446611Help
Entry
446611            CDS       T01010                                 

Gene name
hexdc
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    446611 (hexdc)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     446611 (hexdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 379 aa AA seqDB search
MEFVLKHGVFSHLREVEGFTNTLNPHKEQSLQLVQAMIGQVMELHPDARWLHIGSDEVYF
LGEGRESKEIIANTQITVQEIFLHHLKAVTSHVASAYSGVRPIAWDDMLRDANEQVLTES
GVTHLLELMIWDYSPDLDVDKKVAMVAKYKQCGFQKLWFASAFKGATGVKEQLTSINHHL
GNNNQWLKVAAKIPQELLQGIALTGWQRYDHFSVLCELLPVAIPCVAVCLQFLKHGEYSD
QVIEQVKSFLGMTELENLGSISSGSFPGNKVLSLVTQLICNLRPELKELLEENKFVGGWF
SPYHRRTNVINPVMVQEIQPATMSLMSRWQTLHEELQNELLQIYPSSTVVEWMEVNVLPW
YLQIKKLCEDLNAALQNPL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgtactgaagcacggggtattctctcacctgagagaggttgagggctttaca
aacaccctgaacccacacaaagaacaatctctgcagctggttcaagccatgattggccaa
gtgatggagttacaccctgatgcccgctggctgcacattggctctgatgaggtgtatttc
ctcggagagggcagagagtccaaggaaatcatagccaatacccaaatcacagtacaggaa
atctttttacaccatctgaaggctgtgacttcacacgtggcctcagcttactcaggggtc
cgacccatagcttgggatgacatgcttcgtgatgctaacgaacaagtgctgacagagtca
ggtgtgacacatctgttggaactgatgatatgggactacagtccagacctggacgttgac
aaaaaagttgctatggtggctaaatacaagcagtgcggtttccagaagttatggttcgca
agtgctttcaagggggccactggagtcaaggaacagctcaccagtatcaatcatcacctt
ggaaacaacaaccagtggctaaaagtggcagcaaagataccacaggagttgctacaggga
atagcgctaacaggctggcagaggtacgaccacttctcagttctgtgtgagcttctgcct
gtggctattccttgtgtggccgtgtgcctgcagtttctgaagcatggtgaatattctgac
caggtgatagagcaagtcaaaagctttctgggaatgacagaactggaaaatttgggaagc
atctcaagtggctcattcccgggcaacaaggtcctctcccttgtcactcagctcatctgt
aacttaaggccagaactgaaggagttactggaagagaacaagtttgttggcggctggttt
agcccataccacaggaggacaaatgtaattaaccctgtaatggtgcaggagatccagcca
gccaccatgagcctcatgtcccgatggcagacactacacgaagaactgcaaaacgagctg
ctgcaaatctatccctctagcacggtagtagaatggatggaggtgaatgtcctaccctgg
tacctccagattaagaaactgtgtgaagatttaaatgctgcgctgcagaatcccctgtag

DBGET integrated database retrieval system