KEGG   Xenopus laevis (African clawed frog): 446642Help
Entry
446642            CDS       T01010                                 

Gene name
guk1.S, gmk
Definition
(RefSeq) guanylate kinase 1 S homeolog
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    446642 (guk1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     446642 (guk1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
6S
AA seq 198 aa AA seqDB search
MAGPRPVVLTGPSGAGKSTLLKMLMREYEGLFGFSVSHTTRKPRPGEVHGKDYHFVTLED
MKKGVERGDFIEHAVFSGNMYGTSTAAVQAVQANNQICILDIDMQGVKSIKKTRLNPIYI
SIHPPSVQILEKRLRDRNTESEESLQKRLNAAIADLEISKEPGLFDAIIVNDDLEEAYTK
LKGILGEEIKQTQSNKNS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcccaggccagttgtgctgaccggaccctccggagcaggaaaaagtaccctc
ctgaagatgctcatgagagaatatgaaggactatttggcttttcagtttctcataccaca
agaaagccccggcctggggaagttcatggtaaagattatcactttgtgactctcgaggac
atgaagaagggagtagagagaggggactttatagaacatgcagtgttttctggcaacatg
tatgggaccagtacagcagccgtgcaggccgtccaggccaataatcagatctgtatactg
gacatcgacatgcagggagtgaagagcatcaagaagacccgtctgaatcccatttacatc
tccattcaccctccgtccgttcagatattagaaaagcggctgcgagacagaaatacagag
tcggaggaaagtttacagaagagactgaacgcggccatcgcagacctggagatcagcaaa
gagccaggcctgtttgatgccattattgttaatgatgatttagaagaggcatacactaaa
ctgaaggggattctgggagaagagataaaacaaacccaaagcaacaagaattcctga

DBGET integrated database retrieval system