KEGG   Xenopus laevis (African clawed frog): 446719Help
Entry
446719            CDS       T01010                                 

Gene name
cdkn2d, ink4d, p19, p19-ink4d
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    446719 (cdkn2d)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    446719 (cdkn2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 161 aa AA seqDB search
MLLQETSAGDRLTRAAARGDLTEVKRLLHEERIHPDCLNCFGKTALQVMMFGSTPVASEL
LKQGATPNIQDAYGTTPAHDAARCGFLDTLQVLVQHGAEVNTPDASGSLPIHLALKAGHV
PVITYLALISDLQQHDREGHTPSQLAAILDPRLASIFELST
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttgctacaagagaccagcgctggagaccgcctgacacgagcggctgccaggggagac
ctaacagaagtaaaaaggcttctccatgaagagaggatccaccctgactgcctgaactgc
tttgggaaaactgctctgcaggtcatgatgtttggcagcaccccagttgcatcggagctt
ttgaaacaaggcgccactcctaatattcaagatgcatatggcaccacccctgctcatgat
gctgctcgctgcggtttcctcgacaccctgcaggttttagtccaacatggagcagaggtg
aacacacctgatgcctctggctccctacctatacacctggcccttaaagcaggtcatgta
cctgtcattacctaccttgcccttatctctgaccttcagcaacatgatcgggaagggcat
acgccatcacagttggccgccatcttggatcctcgtctggcttccatatttgagctcagc
acatag

DBGET integrated database retrieval system