KEGG   Xenopus laevis (African clawed frog): 446719Help
Entry
446719            CDS       T01010                                 

Gene name
cdkn2d, ink4d, p19, p19-ink4d
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 161 aa AA seqDB search
MLLQETSAGDRLTRAAARGDLTEVKRLLHEERIHPDCLNCFGKTALQVMMFGSTPVASEL
LKQGATPNIQDAYGTTPAHDAARCGFLDTLQVLVQHGAEVNTPDASGSLPIHLALKAGHV
PVITYLALISDLQQHDREGHTPSQLAAILDPRLASIFELST
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttgctacaagagaccagcgctggagaccgcctgacacgagcggctgccaggggagac
ctaacagaagtaaaaaggcttctccatgaagagaggatccaccctgactgcctgaactgc
tttgggaaaactgctctgcaggtcatgatgtttggcagcaccccagttgcatcggagctt
ttgaaacaaggcgccactcctaatattcaagatgcatatggcaccacccctgctcatgat
gctgctcgctgcggtttcctcgacaccctgcaggttttagtccaacatggagcagaggtg
aacacacctgatgcctctggctccctacctatacacctggcccttaaagcaggtcatgta
cctgtcattacctaccttgcccttatctctgaccttcagcaacatgatcgggaagggcat
acgccatcacagttggccgccatcttggatcctcgtctggcttccatatttgagctcagc
acatag

DBGET integrated database retrieval system